(data stored in ACNUC7421 zone)

EMBL: CP002343.PE129

CP002343.PE129       Location/Qualifiers
FT   CDS             138440..139300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0130"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase;
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="COGs: COG0266 Formamidopyrimidine-DNA glycosylase;
FT                   InterPro IPR012319: IPR015886: IPR000214; KEGG:
FT                   sna:Snas_1400 DNA-formamidopyrimidine glycosylase; PFAM:
FT                   DNA glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; PRIAM: DNA-(apurinic or apyrimidinic site) lyase;
FT                   SPTR: Putative formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase H2TH domain;
FT                   Formamidopyrimidine-DNA glycosylase N-terminal domain;
FT                   TIGRFAM: formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46691"
FT                   /db_xref="GOA:E6SFF3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF3"
FT                   /protein_id="ADU46691.1"
FT                   /translation="MPELPEVQALVDFLAERTAGLAVTKVELASISALKTFNPPPQSLE
FT                   GAPIDGVHRHGKFLDIDCDGTHLVFHLARAGWLRWSDQLPTTVLRPGKSPIALRVRLSD
FT                   GSGFDLTEAGTKKSLAAYIVRDPKEVPGVARLGPDPLADDFTLERFRELLTGRRTQIKG
FT                   LLRDQEVIAGVGNAYSDEILHVAKVSPFAIAGSLPPDVVDRLYAALRETLSSAVHAASG
FT                   KPAKELKDAKRAGMRVHARTGQACPECGDVVREVSFADTSLQYCATCQTGGKPLADRRM
FT                   SRLLK"
     MPELPEVQAL VDFLAERTAG LAVTKVELAS ISALKTFNPP PQSLEGAPID GVHRHGKFLD        60
     IDCDGTHLVF HLARAGWLRW SDQLPTTVLR PGKSPIALRV RLSDGSGFDL TEAGTKKSLA       120
     AYIVRDPKEV PGVARLGPDP LADDFTLERF RELLTGRRTQ IKGLLRDQEV IAGVGNAYSD       180
     EILHVAKVSP FAIAGSLPPD VVDRLYAALR ETLSSAVHAA SGKPAKELKD AKRAGMRVHA       240
     RTGQACPECG DVVREVSFAD TSLQYCATCQ TGGKPLADRR MSRLLK                      286
//

If you have problems or comments...

PBIL Back to PBIL home page