(data stored in ACNUC7421 zone)

EMBL: CP002343.PE13

CP002343.PE13        Location/Qualifiers
FT   CDS             complement(17096..18301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0013"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: fra:Francci3_4274 phage
FT                   integrase; PFAM: integrase family protein; SPTR: Integrase
FT                   family protein; PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46575"
FT                   /db_xref="GOA:E6SDX2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX2"
FT                   /protein_id="ADU46575.1"
FT                   /translation="MARRHNGEGTIYPYRNGYAAQVWVYTPEGRRQRKTVYGKTREIVH
FT                   EKWLALHAQARRGPVSPRTPKVDEFATGWLRDVVTPNLAPATVANYELFVRHYISPAFG
FT                   SKRLDRLGVRDVQVWLNELKHTCQCCAQGKDAAREVPRCCAKGKCCGQVASEWTIHQAW
FT                   TVLRSLLSSAMREELVSRNVAGLVRVPVPRAKKPAVWTVDQARQFLESARRDDDPLYAG
FT                   YVLMLILGLRRGELLGLAWDDVDLELGEARIAWQVQRVKGQLLRRKTKTTSSDAPLPLP
FT                   EICVSALEQRRVVEAKWRLAAGEAWAGAGLVMTTRLGDPLDPRNFHRYFKARATKAGVP
FT                   VISVHATRRTCASLLVALDVHPRVAMAILRHSKIAVTMDIYSQVSSTSTREALKRLGEA
FT                   FG"
     MARRHNGEGT IYPYRNGYAA QVWVYTPEGR RQRKTVYGKT REIVHEKWLA LHAQARRGPV        60
     SPRTPKVDEF ATGWLRDVVT PNLAPATVAN YELFVRHYIS PAFGSKRLDR LGVRDVQVWL       120
     NELKHTCQCC AQGKDAAREV PRCCAKGKCC GQVASEWTIH QAWTVLRSLL SSAMREELVS       180
     RNVAGLVRVP VPRAKKPAVW TVDQARQFLE SARRDDDPLY AGYVLMLILG LRRGELLGLA       240
     WDDVDLELGE ARIAWQVQRV KGQLLRRKTK TTSSDAPLPL PEICVSALEQ RRVVEAKWRL       300
     AAGEAWAGAG LVMTTRLGDP LDPRNFHRYF KARATKAGVP VISVHATRRT CASLLVALDV       360
     HPRVAMAILR HSKIAVTMDI YSQVSSTSTR EALKRLGEAF G                           401
//

If you have problems or comments...

PBIL Back to PBIL home page