(data stored in SCRATCH zone)

EMBL: CP002343.PE130

CP002343.PE130       Location/Qualifiers
FT   CDS             139346..140203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0131"
FT                   /product="Pyridoxal kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="COGs: COG2240 Pyridoxal/pyridoxine/pyridoxamine
FT                   kinase; InterPro IPR013749: IPR004625; KEGG: nca:Noca_4006
FT                   pyridoxamine kinase; PFAM: Phosphomethylpyrimidine kinase
FT                   type-1; PRIAM: Pyridoxal kinase; SPTR: Pyridoxal kinase;
FT                   TIGRFAM: pyridoxal kinase; PFAM: Phosphomethylpyrimidine
FT                   kinase; TIGRFAM: pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46692"
FT                   /db_xref="GOA:E6SFF4"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF4"
FT                   /protein_id="ADU46692.1"
FT                   /translation="MTSVKILSIQSHVAYGHAGNSAAVFPLQRLGHDVYPVLTVTFSNH
FT                   TGYGATRGPLIAPDDIAEVLLGIEERGAFPHIDAVLSGYQGAESVGAVILDAVARVKAA
FT                   NPSALYCCDPVMGDVGRGFFVREGIPEFIRDEVVPRADIITPNHFELEFLVGRPLATQQ
FT                   AVVAAAEELGARGPQVVLVTSTLTEDTPGDCIQMTCVAHAGAWVVTTPLLPMTVKGGGD
FT                   VTAALFLAHYLTDGPRLALVRTAATMHAILEGTHAAGSEEMLLVAGQDAIAQPGETVEI
FT                   SQIR"
     MTSVKILSIQ SHVAYGHAGN SAAVFPLQRL GHDVYPVLTV TFSNHTGYGA TRGPLIAPDD        60
     IAEVLLGIEE RGAFPHIDAV LSGYQGAESV GAVILDAVAR VKAANPSALY CCDPVMGDVG       120
     RGFFVREGIP EFIRDEVVPR ADIITPNHFE LEFLVGRPLA TQQAVVAAAE ELGARGPQVV       180
     LVTSTLTEDT PGDCIQMTCV AHAGAWVVTT PLLPMTVKGG GDVTAALFLA HYLTDGPRLA       240
     LVRTAATMHA ILEGTHAAGS EEMLLVAGQD AIAQPGETVE ISQIR                       285
//

If you have problems or comments...

PBIL Back to PBIL home page