(data stored in ACNUC7421 zone)

EMBL: CP002343.PE133

CP002343.PE133       Location/Qualifiers
FT   CDS             142246..142485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_28560 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46695"
FT                   /db_xref="GOA:E6SFF7"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF7"
FT                   /protein_id="ADU46695.1"
FT                   /translation="MNAELHDRPETVVPGFWMTILGSILAVIAPLAGFLGGSSTGAVAR
FT                   EGQLGTWLLVGLVIGGLGVLVAFVGAQRWWRATH"
     MNAELHDRPE TVVPGFWMTI LGSILAVIAP LAGFLGGSST GAVAREGQLG TWLLVGLVIG        60
     GLGVLVAFVG AQRWWRATH                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page