(data stored in SCRATCH zone)

EMBL: CP002343.PE134

CP002343.PE134       Location/Qualifiers
FT   CDS             142562..143134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0135"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR007627: IPR013249: IPR014284; KEGG: ace:Acel_0379 ECF
FT                   subfamily RNA polymerase sigma-24 factor; PFAM: Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; SPTR:
FT                   RNA polymerase, sigma-24 subunit, ECF subfamily; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70, region 4; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46696"
FT                   /db_xref="GOA:E6SFF8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF8"
FT                   /protein_id="ADU46696.1"
FT                   /translation="MIGADFQTVLADAQGGDEYAFARLWRDLNPALLRYLSLGGEMAEE
FT                   VAAETWTTVVRGLARFEGDETAWRAWVFTTARRRAVDAGRKRAREAGLGWRANTWAAEV
FT                   SPDSAEAVIEAATTEDMLRLVRTLPASQAEAVLLRVVAGLPVAEVAELLGRSPGSVRVA
FT                   CHRGLESLAKKLSKQDVTDGALRALRG"
     MIGADFQTVL ADAQGGDEYA FARLWRDLNP ALLRYLSLGG EMAEEVAAET WTTVVRGLAR        60
     FEGDETAWRA WVFTTARRRA VDAGRKRARE AGLGWRANTW AAEVSPDSAE AVIEAATTED       120
     MLRLVRTLPA SQAEAVLLRV VAGLPVAEVA ELLGRSPGSV RVACHRGLES LAKKLSKQDV       180
     TDGALRALRG                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page