(data stored in ACNUC7421 zone)

EMBL: CP002343.PE135

CP002343.PE135       Location/Qualifiers
FT   CDS             143106..143900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_3793 protein tyrosine phosphatase,
FT                   receptor type, F -like protein; SPTR: Protein tyrosine
FT                   phosphatase, receptor type, F (Predicted)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46697"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF9"
FT                   /protein_id="ADU46697.1"
FT                   /translation="MAPCGRFGGDMSNEKQSEGFPDRAGSHDDLLDEVAANPELARVAF
FT                   LLSARPSDRELSGLDGPLDAFRAQVTAPKPQRRRPSMISTLAGAKLGATIAGIAVGLGG
FT                   AATVAYVSASTPATPETHATAATTPSQADAAADARENGKGEGKKDKATPVGPDATGWAA
FT                   FGLGTAWKGVAGNGKAMESVAFQNLVTAAGGEDEVEAFCAEVDAPGSSGDHATGKPEIA
FT                   PTGKPDSVPSATPSQRPEMTPTPPAKPDTVPTASPSHPTGRS"
     MAPCGRFGGD MSNEKQSEGF PDRAGSHDDL LDEVAANPEL ARVAFLLSAR PSDRELSGLD        60
     GPLDAFRAQV TAPKPQRRRP SMISTLAGAK LGATIAGIAV GLGGAATVAY VSASTPATPE       120
     THATAATTPS QADAAADARE NGKGEGKKDK ATPVGPDATG WAAFGLGTAW KGVAGNGKAM       180
     ESVAFQNLVT AAGGEDEVEA FCAEVDAPGS SGDHATGKPE IAPTGKPDSV PSATPSQRPE       240
     MTPTPPAKPD TVPTASPSHP TGRS                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page