(data stored in SCRATCH zone)

EMBL: CP002343.PE136

CP002343.PE136       Location/Qualifiers
FT   CDS             complement(144053..149638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0137"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterProIPR005481: IPR005479: IPR005482:
FT                   IPR000089: IPR 000022: IPR011761: IPR011764: IPR011763;
FT                   KEGG: kfl:Kfla_3307 carbamoyl-phosphate synthase L chain
FT                   ATP-binding protein; PFAM: Carbamoyl-phosphate synthase L
FT                   chain ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain domain protein; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein;
FT                   carboxyl transferase; SPTR: Carbamoyl-phosphate synthase L
FT                   chain ATP-binding protein; PFAM: Carboxyl transferase
FT                   domain; Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Biotin carboxylase C-terminal domain; Acetyl-CoA
FT                   carboxylase, central region; Carbamoyl-phosphate synthase L
FT                   chain, N-terminal domain; Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46698"
FT                   /db_xref="GOA:E6SFG0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG0"
FT                   /protein_id="ADU46698.1"
FT                   /translation="MISRIAIVNRGEAAMRLIHAVRDLNAQHAVEGRSDQRIETIALHT
FT                   EGERRAMFVRESDHAYDLGPAANRPYIDHAVLERALRETGADAAWVGWGFVAEDPAFAE
FT                   LCERIGVIFIGPSAEAMRQLGDKIGSKLIAEEVGVPVAPWSRGGVDTLEEATEAAARIG
FT                   YPLMLKATAGGGGRGIRKVESDAELTEAYERTRDEAARAFGSGVVFLEKLVTGARHIEV
FT                   QVIGDGQGTAWAVGVRDCSVQRRNQKVIEESASPVLSADEAAEVRTAAERLAVAVGYAG
FT                   AGTVEFLYHPAEKFFAFLEVNTRLQVEHPITEATTDTDLVKLQIHVANGGRLEGARPVE
FT                   RGHAVEARLNAEDPDRDFAPAPGRIALLDFPSGPGIRVDTGVGEGDSIPADFDSMIAKI
FT                   IAYGRDRDEALARLRRAMAETTVVIEGGATNKSFILDLLDQPEVIDGSADTGWIDRVRG
FT                   EGRLMSQRHSGIALVAAGIEAYEEAEAIERARLLETARGGRPQAHHQVGRGVDLKLRGT
FT                   IHKVNVLRIAPHRYRVTVGSGASGDDGQVVEAQLDRIDDYQSRIVVGGQNHRLITALHG
FT                   PVLLVEVDGVTHRVSRDEGGVLRSPAPALVVAAPVQVGDEVAAGAPVLVLESMKMETVL
FT                   AAPFAARVKEILVGVGGQVETGAALVRLEPTGDEDEPGAGASPAPTVDLDLPDCTVADE
FT                   TLRDRIARGVSELSAGVLGFDNDDNGTHRSLTAYLSARDEAAADGTSPIAEEIILLELV
FT                   ADFAELSRNRPAEEERHTELLVHTPREHFHTYLQSLDADRAGLPAAFRDKLARVLRHYG
FT                   VTELDRTPDLEEAVFRIFLAQQRTSPEIALATSLLQRWLGEPTPEARNAAAARDTLDRL
FT                   VLATQLRFPVIGDLARSVRFRWFEQPMVDAERQSVLAGVRDQLESLTAEAERVGDEGGA
FT                   TPETVSPDYAAGIDELAAIPEQIVRFLAERLDRPDDSIPRHEPMIEVLIKRHYHEHDLH
FT                   GPHRFHAGDRPFAVADYTLDGRPTHLTSTIGDVAELAPGSDLDVSVGNDVWSRAEQHHA
FT                   VVDLYLRWRDQPADPEEVSATLATRLKALDWTRDVRRVAVAVTGNHDQPVGYFTFRPQG
FT                   EELVEDRLVRGVHPMVGRRLQLWRLRDFEVTRLEAPEDVFLYECVARDNADDRRIVASA
FT                   QVRQLVVVRDDDGRVSGLPQAERAIANCLDAIRRVRASRGSAGSRLDMNYVWVTIWPII
FT                   EADLEQLTALQAKIAPLTVGAGVEEVLVQARVVLDPEEGPVTIAGRFSYQPGSGVVGTV
FT                   GQPPAEPLKPLDDYASKVVRARRRGLVYPYELQSMIAGDGGTVVEHDLDDAGRLVPVDR
FT                   PFGLNKAGIIVALVTSPTERHPQGVQRVVLSGDPLRSLGSVAEAECARVIAALDLAEER
FT                   GIPVEWYSLSAGARISMDSGTENMDWVARALKRIIEFTQAGQEINIVVAGINVGAQPYW
FT                   NAEATMLMHTKGILVMTPDSAMVLTGKQSLDFSGGVSAEDNFGIGGYDRVMGPNGQAQY
FT                   WAKDLAAARDILMTHYDHAYVAPGEGGPRRVATSDPIDRDVTSYPHSLPDSGFTTVGDI
FT                   FSAEKNPDRKKPFDIRTLMRALTDQDHATLERWAGMADAETAVVQDAHLGGIPVCLIGI
FT                   ESKSVPRRGFPPTDGPDTYTAGTLFPRSSKKVARAINAASGNRPVVILANLSGFDGSPE
FT                   SMRSLQLEYGAEIGRAIVNFDGPIVFTVVSRYHGGAFVVFSKALNPRMTVLAIEGSFAS
FT                   VIGGAPAAAVVFARDVDARTAADSRVAELAARVDASEGVERAQLATELADLRATVRAEK
FT                   LGAVAAEFDSVHSIHRAVAVGSVDEVIEASDLRPRIISALEAGLTP"
     MISRIAIVNR GEAAMRLIHA VRDLNAQHAV EGRSDQRIET IALHTEGERR AMFVRESDHA        60
     YDLGPAANRP YIDHAVLERA LRETGADAAW VGWGFVAEDP AFAELCERIG VIFIGPSAEA       120
     MRQLGDKIGS KLIAEEVGVP VAPWSRGGVD TLEEATEAAA RIGYPLMLKA TAGGGGRGIR       180
     KVESDAELTE AYERTRDEAA RAFGSGVVFL EKLVTGARHI EVQVIGDGQG TAWAVGVRDC       240
     SVQRRNQKVI EESASPVLSA DEAAEVRTAA ERLAVAVGYA GAGTVEFLYH PAEKFFAFLE       300
     VNTRLQVEHP ITEATTDTDL VKLQIHVANG GRLEGARPVE RGHAVEARLN AEDPDRDFAP       360
     APGRIALLDF PSGPGIRVDT GVGEGDSIPA DFDSMIAKII AYGRDRDEAL ARLRRAMAET       420
     TVVIEGGATN KSFILDLLDQ PEVIDGSADT GWIDRVRGEG RLMSQRHSGI ALVAAGIEAY       480
     EEAEAIERAR LLETARGGRP QAHHQVGRGV DLKLRGTIHK VNVLRIAPHR YRVTVGSGAS       540
     GDDGQVVEAQ LDRIDDYQSR IVVGGQNHRL ITALHGPVLL VEVDGVTHRV SRDEGGVLRS       600
     PAPALVVAAP VQVGDEVAAG APVLVLESMK METVLAAPFA ARVKEILVGV GGQVETGAAL       660
     VRLEPTGDED EPGAGASPAP TVDLDLPDCT VADETLRDRI ARGVSELSAG VLGFDNDDNG       720
     THRSLTAYLS ARDEAAADGT SPIAEEIILL ELVADFAELS RNRPAEEERH TELLVHTPRE       780
     HFHTYLQSLD ADRAGLPAAF RDKLARVLRH YGVTELDRTP DLEEAVFRIF LAQQRTSPEI       840
     ALATSLLQRW LGEPTPEARN AAAARDTLDR LVLATQLRFP VIGDLARSVR FRWFEQPMVD       900
     AERQSVLAGV RDQLESLTAE AERVGDEGGA TPETVSPDYA AGIDELAAIP EQIVRFLAER       960
     LDRPDDSIPR HEPMIEVLIK RHYHEHDLHG PHRFHAGDRP FAVADYTLDG RPTHLTSTIG      1020
     DVAELAPGSD LDVSVGNDVW SRAEQHHAVV DLYLRWRDQP ADPEEVSATL ATRLKALDWT      1080
     RDVRRVAVAV TGNHDQPVGY FTFRPQGEEL VEDRLVRGVH PMVGRRLQLW RLRDFEVTRL      1140
     EAPEDVFLYE CVARDNADDR RIVASAQVRQ LVVVRDDDGR VSGLPQAERA IANCLDAIRR      1200
     VRASRGSAGS RLDMNYVWVT IWPIIEADLE QLTALQAKIA PLTVGAGVEE VLVQARVVLD      1260
     PEEGPVTIAG RFSYQPGSGV VGTVGQPPAE PLKPLDDYAS KVVRARRRGL VYPYELQSMI      1320
     AGDGGTVVEH DLDDAGRLVP VDRPFGLNKA GIIVALVTSP TERHPQGVQR VVLSGDPLRS      1380
     LGSVAEAECA RVIAALDLAE ERGIPVEWYS LSAGARISMD SGTENMDWVA RALKRIIEFT      1440
     QAGQEINIVV AGINVGAQPY WNAEATMLMH TKGILVMTPD SAMVLTGKQS LDFSGGVSAE      1500
     DNFGIGGYDR VMGPNGQAQY WAKDLAAARD ILMTHYDHAY VAPGEGGPRR VATSDPIDRD      1560
     VTSYPHSLPD SGFTTVGDIF SAEKNPDRKK PFDIRTLMRA LTDQDHATLE RWAGMADAET      1620
     AVVQDAHLGG IPVCLIGIES KSVPRRGFPP TDGPDTYTAG TLFPRSSKKV ARAINAASGN      1680
     RPVVILANLS GFDGSPESMR SLQLEYGAEI GRAIVNFDGP IVFTVVSRYH GGAFVVFSKA      1740
     LNPRMTVLAI EGSFASVIGG APAAAVVFAR DVDARTAADS RVAELAARVD ASEGVERAQL      1800
     ATELADLRAT VRAEKLGAVA AEFDSVHSIH RAVAVGSVDE VIEASDLRPR IISALEAGLT      1860
     P                                                                      1861
//

If you have problems or comments...

PBIL Back to PBIL home page