(data stored in ACNUC7421 zone)

EMBL: CP002343.PE137

CP002343.PE137       Location/Qualifiers
FT   CDS             complement(149823..150323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pan:PODANSg8735 hypothetical protein; SPTR:
FT                   Predicted CDS Pa_2_8850"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46699"
FT                   /db_xref="GOA:E6SFG1"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG1"
FT                   /protein_id="ADU46699.1"
FT                   /translation="MPRSRRRGYGPYEPLGEGPGRRRPWLRTAQLNVRGWSALIGLCAL
FT                   AGLAGTLLARAIDVPAWAGSPLALLPLGAVILVDRRRWAAMETSYGWGGSVADVSRMVE
FT                   ELRAYGVAAAVRPDPRYEQPWWDRIDSPADPEPTASLVYANRDEAAVRTVLRGHGVDLP
FT                   DLP"
     MPRSRRRGYG PYEPLGEGPG RRRPWLRTAQ LNVRGWSALI GLCALAGLAG TLLARAIDVP        60
     AWAGSPLALL PLGAVILVDR RRWAAMETSY GWGGSVADVS RMVEELRAYG VAAAVRPDPR       120
     YEQPWWDRID SPADPEPTAS LVYANRDEAA VRTVLRGHGV DLPDLP                      166
//

If you have problems or comments...

PBIL Back to PBIL home page