(data stored in SCRATCH zone)

EMBL: CP002343.PE141

CP002343.PE141       Location/Qualifiers
FT   CDS             complement(152767..154188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0142"
FT                   /product="tyrosine phenol-lyase"
FT                   /EC_number="4.1.99.2"
FT                   /note="COGs: COG3033 Tryptophanase; InterPro IPR001597:
FT                   IPR011166: IPR013441; KEGG: sth:STH2842 tyrosine
FT                   phenol-lyase; PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; PRIAM: Tyrosine phenol-lyase;
FT                   SPTR: Tyrosine phenol-lyase; TIGRFAM: tyrosine
FT                   phenol-lyase; PFAM: Beta-eliminating lyase; TIGRFAM:
FT                   tyrosine phenol-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46703"
FT                   /db_xref="GOA:E6SFG5"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR013441"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:E6SFG5"
FT                   /protein_id="ADU46703.1"
FT                   /translation="MPAIAEPYRIKMVEPITMTTREQREAAIRAAGYNTFLLRSDDVYI
FT                   DLLTDSGTSAMSDRQWSAMMMGDEAYAGARSFDHLVESVRENYGFPLVCPTHQGRGAEH
FT                   LISKILITPGQHVPGNMYFTTTRVHQELAGGTFHDVIIDEAHDPASRHPFKGNVDLDKF
FT                   QALIDEVGADQIAYINVAVTVNMAGGQPVSMANIRAVREICDRYGIILWSDATRLAENA
FT                   WFIQEREDGYAGRPVAEIVREMLSHFDGITMSGKKDCLVNIGGFLAMRDEAILTKAREL
FT                   VVVYEGMPTYGGLAGRDLDAMAVGLREALDDDYLTHRIGQVRYLGERLQAAGVPIVEPI
FT                   GGHAVFIDAAAFLDHLSQDELPAQTLAAEIFLDSGVRSMERGIVSAGRDADGNNRYPKL
FT                   ELVRLTIPRRVYTNSHMDVVADSVIRVFQRRREIQGLTFVYESPTLRFFTSRFEPLAAE
FT                   AALEEGRPEPALAGA"
     MPAIAEPYRI KMVEPITMTT REQREAAIRA AGYNTFLLRS DDVYIDLLTD SGTSAMSDRQ        60
     WSAMMMGDEA YAGARSFDHL VESVRENYGF PLVCPTHQGR GAEHLISKIL ITPGQHVPGN       120
     MYFTTTRVHQ ELAGGTFHDV IIDEAHDPAS RHPFKGNVDL DKFQALIDEV GADQIAYINV       180
     AVTVNMAGGQ PVSMANIRAV REICDRYGII LWSDATRLAE NAWFIQERED GYAGRPVAEI       240
     VREMLSHFDG ITMSGKKDCL VNIGGFLAMR DEAILTKARE LVVVYEGMPT YGGLAGRDLD       300
     AMAVGLREAL DDDYLTHRIG QVRYLGERLQ AAGVPIVEPI GGHAVFIDAA AFLDHLSQDE       360
     LPAQTLAAEI FLDSGVRSME RGIVSAGRDA DGNNRYPKLE LVRLTIPRRV YTNSHMDVVA       420
     DSVIRVFQRR REIQGLTFVY ESPTLRFFTS RFEPLAAEAA LEEGRPEPAL AGA              473
//

If you have problems or comments...

PBIL Back to PBIL home page