(data stored in SCRATCH zone)

EMBL: CP002343.PE142

CP002343.PE142       Location/Qualifiers
FT   CDS             complement(154352..157309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0143"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COGs: COG3899 ATPase; InterPro IPR000792; KEGG:
FT                   nca:Noca_4382 regulatory protein, LuxR; PFAM: regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; SPTR:
FT                   Putative LuxR-family transcriptional regulator; PFAM:
FT                   Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46704"
FT                   /db_xref="GOA:E6SFG6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG6"
FT                   /protein_id="ADU46704.1"
FT                   /translation="MPFTTGALVGRGSELARLAGAVGLVDSLDGTRGGVAIVSGDAGIG
FT                   KSRLLLQLTTDADRAGWLTATGHCVGQAGSALAYLPFVELIGLLDRMTPDVVTQVLGSH
FT                   PSLARLLPRRDGVTGTGGGADSAKEASPGLVAESVHALLTAFGAVRPTLVVIEDVHWAD
FT                   HSSRDLLTLLLTRSFTTPVALVASYRSDDLHRKHPLHETLAVWDRIPHVTHVSLAPLPD
FT                   AAVDEIVEGIEGVPDDPRTMREITRRAEGNPFFAEELAASAVAGQQVSGGLGRVLRARV
FT                   ERLDETSQAVVRAVSLKGGRFIGHELLSRIMGLPEPVLEAAIAQAVEHHVLETSWPPAY
FT                   TFRHALLGETAAESLLPGERLRLHKAYAAVLAECPHLAPASELARHAAASGDLPAAVAA
FT                   SRAAAESAMEVGGPQDALFHLEQALSWLEDDAAERDEVTIRASEAATAAGDILRAVRLL
FT                   KDGIDHPGPRQRDEVRAELLARYATLSRMLDLPVEGLALTSRAVDLLPDEETPRQVLVL
FT                   IAHVQQLVDAGELDDAVRTGDEVMATAERLGLRESLLEIRTILTRVIEAQQDLDAVEAH
FT                   LRGLFADVRGTDNPIQLRLTHQLAAVAHRRGDLRGALAHYDEGTRIARRLHQEWAPWGL
FT                   DCRLLSGLTAYELGDWDDVPSRLALASKVTPQPARALFEAAALGVAVGRGEPVPPSRLS
FT                   SLREWWYVDGLAVVLTVMPGIDLLGDAGDLTGMLEIACEAAQTLDTAWGKYHASVRLAA
FT                   LVAGQVATLAPRAAPELRERAARTVDDLGRRADQLVAKVIRTSQGTGWDPTDVDVLGES
FT                   STETWAWARRLRAERLRLAWVLGQEDPPPVEEMLVAWRASVEAFDRLGHVFEAARSRGR
FT                   LAAALHAAGRDVDSRQVAGSAREVAVRLRARPLLAELDALAPRAPAAATAVELTPRELE
FT                   VLALVARGLSNGQIGKQLYISTKTVSVHVSNLLAKLGASGRTEAAAIARDRALVP"
     MPFTTGALVG RGSELARLAG AVGLVDSLDG TRGGVAIVSG DAGIGKSRLL LQLTTDADRA        60
     GWLTATGHCV GQAGSALAYL PFVELIGLLD RMTPDVVTQV LGSHPSLARL LPRRDGVTGT       120
     GGGADSAKEA SPGLVAESVH ALLTAFGAVR PTLVVIEDVH WADHSSRDLL TLLLTRSFTT       180
     PVALVASYRS DDLHRKHPLH ETLAVWDRIP HVTHVSLAPL PDAAVDEIVE GIEGVPDDPR       240
     TMREITRRAE GNPFFAEELA ASAVAGQQVS GGLGRVLRAR VERLDETSQA VVRAVSLKGG       300
     RFIGHELLSR IMGLPEPVLE AAIAQAVEHH VLETSWPPAY TFRHALLGET AAESLLPGER       360
     LRLHKAYAAV LAECPHLAPA SELARHAAAS GDLPAAVAAS RAAAESAMEV GGPQDALFHL       420
     EQALSWLEDD AAERDEVTIR ASEAATAAGD ILRAVRLLKD GIDHPGPRQR DEVRAELLAR       480
     YATLSRMLDL PVEGLALTSR AVDLLPDEET PRQVLVLIAH VQQLVDAGEL DDAVRTGDEV       540
     MATAERLGLR ESLLEIRTIL TRVIEAQQDL DAVEAHLRGL FADVRGTDNP IQLRLTHQLA       600
     AVAHRRGDLR GALAHYDEGT RIARRLHQEW APWGLDCRLL SGLTAYELGD WDDVPSRLAL       660
     ASKVTPQPAR ALFEAAALGV AVGRGEPVPP SRLSSLREWW YVDGLAVVLT VMPGIDLLGD       720
     AGDLTGMLEI ACEAAQTLDT AWGKYHASVR LAALVAGQVA TLAPRAAPEL RERAARTVDD       780
     LGRRADQLVA KVIRTSQGTG WDPTDVDVLG ESSTETWAWA RRLRAERLRL AWVLGQEDPP       840
     PVEEMLVAWR ASVEAFDRLG HVFEAARSRG RLAAALHAAG RDVDSRQVAG SAREVAVRLR       900
     ARPLLAELDA LAPRAPAAAT AVELTPRELE VLALVARGLS NGQIGKQLYI STKTVSVHVS       960
     NLLAKLGASG RTEAAAIARD RALVP                                             985
//

If you have problems or comments...

PBIL Back to PBIL home page