(data stored in SCRATCH zone)

EMBL: CP002343.PE143

CP002343.PE143       Location/Qualifiers
FT   CDS             complement(157380..157565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nve:NEMVE_v1g242007 hypothetical protein;
FT                   SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46705"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG7"
FT                   /protein_id="ADU46705.1"
FT                   /translation="MTSSITLITPEFMKAELEARYGPRPRRSWRRRPASSLAVEARAHR
FT                   QRTDEAARLAVPARAH"
     MTSSITLITP EFMKAELEAR YGPRPRRSWR RRPASSLAVE ARAHRQRTDE AARLAVPARA        60
     H                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page