(data stored in SCRATCH zone)

EMBL: CP002343.PE145

CP002343.PE145       Location/Qualifiers
FT   CDS             complement(160388..161863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0146"
FT                   /product="TspO/MBR family protein"
FT                   /note="COGs: COG0702 nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509: IPR004307; KEGG:
FT                   krh:KRH_21230 hypothetical protein; PFAM: TspO/MBR family
FT                   protein; NAD-dependent epimerase/dehydratase; SPTR:
FT                   Putative uncharacterized protein; PFAM: TspO/MBR family;
FT                   NmrA-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46707"
FT                   /db_xref="GOA:E6SFG9"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG9"
FT                   /protein_id="ADU46707.1"
FT                   /translation="MTTQPTPSPTRSPTIRSQNGPAEPNDGRTALVTGASGYIGGQLVP
FT                   RLLAEGWQVRVLTRRAGSLDARPWARDVEVVVGDVADRGDLGKALSGIRTAYYLVHSMD
FT                   DEPDFAERDREAADTFGSAARDAGVQRIVYLGGLHPAGEELSPHLASRVEVGRILLESG
FT                   VPTAVLQAAVVLGDGSVSFDMLRHLTTRLPAMVAPKWLDNRIQPIAVDDVITLLAGAAD
FT                   LPADANRTFDIGGPDVLTYREMIQRFAAVTGMRQRVVVTIPVLTPRLASHWVGLVTPIG
FT                   AGIAKPLVGSLVHEVVAKESDLLELVPVPGGLTGFDDAVRRAMEGTTPDTALRNLALTG
FT                   AAVTAAAVVGSLATQPDSRWYRSLDLPAWQPPKATFPIVWSLLYADLAASTAATLTGLD
FT                   REGEGAARKRRTYLAAVGANLALNAGWSVVFWRARRPGAAALESAVLTASGADLARRSA
FT                   AVNPVAGRALVPYVAWCGFATVLSAAIERRNRR"
     MTTQPTPSPT RSPTIRSQNG PAEPNDGRTA LVTGASGYIG GQLVPRLLAE GWQVRVLTRR        60
     AGSLDARPWA RDVEVVVGDV ADRGDLGKAL SGIRTAYYLV HSMDDEPDFA ERDREAADTF       120
     GSAARDAGVQ RIVYLGGLHP AGEELSPHLA SRVEVGRILL ESGVPTAVLQ AAVVLGDGSV       180
     SFDMLRHLTT RLPAMVAPKW LDNRIQPIAV DDVITLLAGA ADLPADANRT FDIGGPDVLT       240
     YREMIQRFAA VTGMRQRVVV TIPVLTPRLA SHWVGLVTPI GAGIAKPLVG SLVHEVVAKE       300
     SDLLELVPVP GGLTGFDDAV RRAMEGTTPD TALRNLALTG AAVTAAAVVG SLATQPDSRW       360
     YRSLDLPAWQ PPKATFPIVW SLLYADLAAS TAATLTGLDR EGEGAARKRR TYLAAVGANL       420
     ALNAGWSVVF WRARRPGAAA LESAVLTASG ADLARRSAAV NPVAGRALVP YVAWCGFATV       480
     LSAAIERRNR R                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page