(data stored in ACNUC7421 zone)

EMBL: CP002343.PE146

CP002343.PE146       Location/Qualifiers
FT   CDS             complement(161868..162587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0147"
FT                   /product="Abortive infection protein"
FT                   /note="InterPro IPR003675; KEGG: kse:Ksed_01050 CAAX amino
FT                   terminal protease family; PFAM: Abortive infection protein;
FT                   SPTR: Probable integral membrane protein; PFAM: CAAX amino
FT                   terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46708"
FT                   /db_xref="GOA:E6SFH0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH0"
FT                   /protein_id="ADU46708.1"
FT                   /translation="MRGPVAELRAFLDAALVRPVVDARPDPPEMRLRRRVVVALSLVVG
FT                   AALLAWALRIRPGDALFYAATLGLAGVWCLGAVLSGPLRLGLGHTRRGARERPVLQSLA
FT                   LGGLLLGAFLAGALVVARIPVLRAPVDDLLDHARFGSLPVVLGITVLNGIAEELYFRGA
FT                   LYAALPKHAVAVTTVLYALTTVGSGVPLLVLAAVVVGLVTALQRRVTGGILGPVITHVT
FT                   WSTGMLLLLPPVLDLVR"
     MRGPVAELRA FLDAALVRPV VDARPDPPEM RLRRRVVVAL SLVVGAALLA WALRIRPGDA        60
     LFYAATLGLA GVWCLGAVLS GPLRLGLGHT RRGARERPVL QSLALGGLLL GAFLAGALVV       120
     ARIPVLRAPV DDLLDHARFG SLPVVLGITV LNGIAEELYF RGALYAALPK HAVAVTTVLY       180
     ALTTVGSGVP LLVLAAVVVG LVTALQRRVT GGILGPVITH VTWSTGMLLL LPPVLDLVR        239
//

If you have problems or comments...

PBIL Back to PBIL home page