(data stored in SCRATCH zone)

EMBL: CP002343.PE148

CP002343.PE148       Location/Qualifiers
FT   CDS             complement(163956..164708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0149"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002198: IPR002347;
FT                   KEGG: avi:Avi_0085 gluconate 5-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46710"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH2"
FT                   /protein_id="ADU46710.1"
FT                   /translation="MRTALSGQRVWVVGASSGIGAQLADELVRRGASVAVSGRRASELE
FT                   AVSGGRMRSVPVDVTDADAVAEAADAVRDGLGGLDMVIHSAGYWKQFDAASWDREVFAR
FT                   HVEVNLLGLNNVLASVVPGFVEQGRGHVVGIASVAGYRGLAGSEAYGATKAAQLNLLEA
FT                   MRASLPPHGVRVTTVAPGFVRTEMTSVNEFPMPFLIDADEAGRTIADGLERGDDTIVFP
FT                   KRMAVAMAVARLVPGRLWTTLTSRGGRA"
     MRTALSGQRV WVVGASSGIG AQLADELVRR GASVAVSGRR ASELEAVSGG RMRSVPVDVT        60
     DADAVAEAAD AVRDGLGGLD MVIHSAGYWK QFDAASWDRE VFARHVEVNL LGLNNVLASV       120
     VPGFVEQGRG HVVGIASVAG YRGLAGSEAY GATKAAQLNL LEAMRASLPP HGVRVTTVAP       180
     GFVRTEMTSV NEFPMPFLID ADEAGRTIAD GLERGDDTIV FPKRMAVAMA VARLVPGRLW       240
     TTLTSRGGRA                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page