(data stored in ACNUC7421 zone)

EMBL: CP002343.PE15

CP002343.PE15        Location/Qualifiers
FT   CDS             complement(18510..20045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0015"
FT                   /product="replication initiator protein"
FT                   /note="KEGG: fre:Franean1_5522 replication initiator
FT                   protein; SPTR: Replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46577"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX4"
FT                   /protein_id="ADU46577.1"
FT                   /translation="MKSSMFEPEVVQELALKEGVCVRPLLNRVTDRQTGDTTVVVMPCR
FT                   STRESRCPSCANAARRLRIQQCAEGWHLDQEPTGPEQEPEAATDELEEEEDVVDEEEVP
FT                   ERRVRSTRRRSDVADLPLKPTENRTIGAVFEGNLGRRYRPSMFVTLTLPSYGSIATGRG
FT                   VPIDPSSYDYRTAALDALHFTKLLDRWIQNLRRCAGFKVQYFGAIEAQRRLAAHFHVAL
FT                   RGAIPRSILRKVTRATYAQVWWPSCDEPVYVDRVPVWDGVDYLDPDTSIPLTTWEDAMA
FT                   ELDEDPHAKPAHTLSFGRQVDIKGLLGGTPDADRSVRYLTKYLTKAVAETYTQAEVFDA
FT                   EYEAHIDRLHDEVRYLPCTPSCANWLRFGIQPKQAGPGLQPGRCSSAAHDRENLGVGGR
FT                   RVQVSRGWSGKTLSDHRADRAAVVKKVLEEAGYTAPDADRMSAETLATDGEPRYLWQTV
FT                   HLPPQKASEAIITSVLERRRWRNEYDRAKAAQVSTGPPVENHSATDGEVEREE"
     MKSSMFEPEV VQELALKEGV CVRPLLNRVT DRQTGDTTVV VMPCRSTRES RCPSCANAAR        60
     RLRIQQCAEG WHLDQEPTGP EQEPEAATDE LEEEEDVVDE EEVPERRVRS TRRRSDVADL       120
     PLKPTENRTI GAVFEGNLGR RYRPSMFVTL TLPSYGSIAT GRGVPIDPSS YDYRTAALDA       180
     LHFTKLLDRW IQNLRRCAGF KVQYFGAIEA QRRLAAHFHV ALRGAIPRSI LRKVTRATYA       240
     QVWWPSCDEP VYVDRVPVWD GVDYLDPDTS IPLTTWEDAM AELDEDPHAK PAHTLSFGRQ       300
     VDIKGLLGGT PDADRSVRYL TKYLTKAVAE TYTQAEVFDA EYEAHIDRLH DEVRYLPCTP       360
     SCANWLRFGI QPKQAGPGLQ PGRCSSAAHD RENLGVGGRR VQVSRGWSGK TLSDHRADRA       420
     AVVKKVLEEA GYTAPDADRM SAETLATDGE PRYLWQTVHL PPQKASEAII TSVLERRRWR       480
     NEYDRAKAAQ VSTGPPVENH SATDGEVERE E                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page