(data stored in ACNUC7421 zone)

EMBL: CP002343.PE151

CP002343.PE151       Location/Qualifiers
FT   CDS             complement(166764..168044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0152"
FT                   /product="amine oxidase"
FT                   /note="COGs: COG2907 NAD/FAD-binding protein; InterPro
FT                   IPR002937; KEGG: sgr:SGR_5877 putative amine
FT                   oxidoreductase; PFAM: amine oxidase; SPTR: Amine oxidase;
FT                   PFAM: Flavin containing amine oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46713"
FT                   /db_xref="GOA:E6SFH5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH5"
FT                   /protein_id="ADU46713.1"
FT                   /translation="MNQSRPQTTAVIGAGVAGLTAAHVLSRTDAVTLFEADQRVGGHAH
FT                   THTVPAGGSTAGASPLRIDSGFIVHNERTYPHLLRLFAELDVETRPTEMSMSITCEQCG
FT                   LSYAGGRGLAGILAQPWRAADPRFVRLLTEVPRFHRAARRLLADPSAEPTWGEFLREGR
FT                   FSTYFVRHFAIPLVATVWSCGDLDAETYPARHLFQFLDHHGMLTVSGSPEWRTVVGGSA
FT                   TYVDRLVARLADVRRSAPVTAVERHDDGVDVRVGDAAPERFDRVVIATHANQALDLLAD
FT                   ALPQEKEDLAAIRYSRNTVWLHRDSSVLPAAKQARAAWNYRMQSCDAPSPQVAVSYWMN
FT                   RLQGLPGTEDHIVTLDPGDHVDPDTVTADLSYEHPVFTAPAVAAAGRLRSAGGERLAFA
FT                   GAHLGWGFHEDGCRSGVEAAQSFGVSW"
     MNQSRPQTTA VIGAGVAGLT AAHVLSRTDA VTLFEADQRV GGHAHTHTVP AGGSTAGASP        60
     LRIDSGFIVH NERTYPHLLR LFAELDVETR PTEMSMSITC EQCGLSYAGG RGLAGILAQP       120
     WRAADPRFVR LLTEVPRFHR AARRLLADPS AEPTWGEFLR EGRFSTYFVR HFAIPLVATV       180
     WSCGDLDAET YPARHLFQFL DHHGMLTVSG SPEWRTVVGG SATYVDRLVA RLADVRRSAP       240
     VTAVERHDDG VDVRVGDAAP ERFDRVVIAT HANQALDLLA DALPQEKEDL AAIRYSRNTV       300
     WLHRDSSVLP AAKQARAAWN YRMQSCDAPS PQVAVSYWMN RLQGLPGTED HIVTLDPGDH       360
     VDPDTVTADL SYEHPVFTAP AVAAAGRLRS AGGERLAFAG AHLGWGFHED GCRSGVEAAQ       420
     SFGVSW                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page