(data stored in ACNUC7421 zone)

EMBL: CP002343.PE152

CP002343.PE152       Location/Qualifiers
FT   CDS             168186..168614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0153"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="InterPro IPR019587; KEGG: art:Arth_3265 hypothetical
FT                   protein; PFAM: Polyketide cyclase/dehydrase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Polyketide cyclase /
FT                   dehydrase and lipid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46714"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH6"
FT                   /protein_id="ADU46714.1"
FT                   /translation="MQFVRTLTVPVPADRVFAYLADFTTTTEWDPATVRTERISGTGGV
FT                   GTRYRNRSRFMGREAEVDYVVTELDPGRHILLRGENQSLVAHDDMTVEGDASGATVTYS
FT                   ASFDLKGLWKLATPVLAPALKRLVDQGADGLRRTLHTL"
     MQFVRTLTVP VPADRVFAYL ADFTTTTEWD PATVRTERIS GTGGVGTRYR NRSRFMGREA        60
     EVDYVVTELD PGRHILLRGE NQSLVAHDDM TVEGDASGAT VTYSASFDLK GLWKLATPVL       120
     APALKRLVDQ GADGLRRTLH TL                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page