(data stored in SCRATCH zone)

EMBL: CP002343.PE153

CP002343.PE153       Location/Qualifiers
FT   CDS             168640..169554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0154"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551: IPR006158; KEGG: msv:Mesil_1484
FT                   transcriptional regulator, MerR family; PFAM: regulatory
FT                   protein MerR; SMART: regulatory protein MerR; SPTR:
FT                   Probable transcriptional regulator; PFAM: MerR family
FT                   regulatory protein; B12 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46715"
FT                   /db_xref="GOA:E6SFH7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH7"
FT                   /protein_id="ADU46715.1"
FT                   /translation="MYTIKRAAELTGISLSTLRAWERRYGVVSPVRSDGRYRLYSADDL
FT                   RALGIMAALVNEGWSAREAAAETKARIEGSAQRGGPLSQVDGGPGPRPEASVLPRVDEL
FT                   VAAAGRLDTVAVSDILDEAFSRAGFERVVDDWLMPALSVIGESWADGRISIAGEHLLSH
FT                   AIQRRLAAAYEAAGARTSGPIVTLGLPPGARHELGVLAFAVALRRAGYSTAYLGADLPA
FT                   GDWGEAVAARGATAVVLAVPRAADVVPARQVCEELLAAHPDLVVFVGGGRQDEVGAGSV
FT                   PLGHDMRTAVEAVDSALNARRPA"
     MYTIKRAAEL TGISLSTLRA WERRYGVVSP VRSDGRYRLY SADDLRALGI MAALVNEGWS        60
     AREAAAETKA RIEGSAQRGG PLSQVDGGPG PRPEASVLPR VDELVAAAGR LDTVAVSDIL       120
     DEAFSRAGFE RVVDDWLMPA LSVIGESWAD GRISIAGEHL LSHAIQRRLA AAYEAAGART       180
     SGPIVTLGLP PGARHELGVL AFAVALRRAG YSTAYLGADL PAGDWGEAVA ARGATAVVLA       240
     VPRAADVVPA RQVCEELLAA HPDLVVFVGG GRQDEVGAGS VPLGHDMRTA VEAVDSALNA       300
     RRPA                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page