(data stored in SCRATCH zone)

EMBL: CP002343.PE155

CP002343.PE155       Location/Qualifiers
FT   CDS             170787..172568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0156"
FT                   /product="sulfate transporter"
FT                   /note="COGs: COG0659 Sulfate permease and related
FT                   transporter (MFS superfamily); InterPro IPR011547:
FT                   IPR002645: IPR001902; KEGG: cef:CE1093 putative sulfate
FT                   transport protein; PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; SPTR:
FT                   Putative sulfate transport protein; TIGRFAM: sulfate
FT                   transporter; PFAM: Sulfate transporter family; STAS domain;
FT                   TIGRFAM: high affinity sulphate transporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46717"
FT                   /db_xref="GOA:E6SFH9"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH9"
FT                   /protein_id="ADU46717.1"
FT                   /translation="MTDQREGAAGWARFAPGLGVLLSYDRTWLRGDVLAGVTVSAYLVP
FT                   QVMAYAEVAGLPAITGLWACAPALVVYALLGSSRQLSVGPESTTALMTAAGIGALAGAA
FT                   GGGRHAELAALLALAVGVVCVLAWLVRLGFLAELLSKPVLVGYMAGIAALMVVSQLGKI
FT                   TGIEVESGTFLEEVGFTATHLGEVHGPTLAVASGVLVVLLAFGRWARRWPGPLIAMVSA
FT                   AALVHVLGLTDEGVRVVGEVPRGLPPLSVPQLDDVEIWKLLPAAVGVAVVAYSDNVLTG
FT                   RAFALKRRETIDSNQEFVALGAANIASSLASGFPVSSSGSRTVLANAMGARTQLHSLVS
FT                   VAVLAATMFWLGPVLATFPTAALGGVVVYAALRLVDVAELRRITGFRHSELVLSLATTV
FT                   AVLGFGVLPGIGVAIVLSVLDLLRRIVHPHDGVLGYVPNVAGMHDIDDHSNAVQVPGLV
FT                   VYRYDSPLFFANSHDFVRRALQAVADSQRTAPVEWFLLNAEANTEVDLTAVDALDTLRL
FT                   SLADEGIRFAMARVKQDMREPLDAAGFVDKVGEDHIFPTLPTAVAAYAKWYEEHHGRPL
FT                   EGLEIPPVPRQPRPPER"
     MTDQREGAAG WARFAPGLGV LLSYDRTWLR GDVLAGVTVS AYLVPQVMAY AEVAGLPAIT        60
     GLWACAPALV VYALLGSSRQ LSVGPESTTA LMTAAGIGAL AGAAGGGRHA ELAALLALAV       120
     GVVCVLAWLV RLGFLAELLS KPVLVGYMAG IAALMVVSQL GKITGIEVES GTFLEEVGFT       180
     ATHLGEVHGP TLAVASGVLV VLLAFGRWAR RWPGPLIAMV SAAALVHVLG LTDEGVRVVG       240
     EVPRGLPPLS VPQLDDVEIW KLLPAAVGVA VVAYSDNVLT GRAFALKRRE TIDSNQEFVA       300
     LGAANIASSL ASGFPVSSSG SRTVLANAMG ARTQLHSLVS VAVLAATMFW LGPVLATFPT       360
     AALGGVVVYA ALRLVDVAEL RRITGFRHSE LVLSLATTVA VLGFGVLPGI GVAIVLSVLD       420
     LLRRIVHPHD GVLGYVPNVA GMHDIDDHSN AVQVPGLVVY RYDSPLFFAN SHDFVRRALQ       480
     AVADSQRTAP VEWFLLNAEA NTEVDLTAVD ALDTLRLSLA DEGIRFAMAR VKQDMREPLD       540
     AAGFVDKVGE DHIFPTLPTA VAAYAKWYEE HHGRPLEGLE IPPVPRQPRP PER              593
//

If you have problems or comments...

PBIL Back to PBIL home page