(data stored in ACNUC7421 zone)

EMBL: CP002343.PE157

CP002343.PE157       Location/Qualifiers
FT   CDS             173626..174459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0158"
FT                   /product="protein of unknown function DUF299"
FT                   /note="COGs: COG1806 conserved hypothetical protein;
FT                   InterPro IPR005177; KEGG: gob:Gobs_2870 protein of unknown
FT                   function DUF299; PFAM: protein of unknown function DUF299;
FT                   SPTR: Putative phosphotransferase JNB_14093; PFAM: Domain
FT                   of unknown function (DUF299)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46719"
FT                   /db_xref="GOA:E6SFI1"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFI1"
FT                   /protein_id="ADU46719.1"
FT                   /translation="MSAPDSVTETPVFFLAGGTGISAETLGNLMLNQFPSVRFRRRKIP
FT                   FITTPEIARQVVAEMDEAMTDAVTPLVFSTVADEEVRTELVKTKCAFIDLFGSHLDAIE
FT                   RVLHVNASHNRAGLHGLGDPRRYEQRMKAIEYAMEHDDGQSLRNLAQAELILVAPSRCG
FT                   KTPTSMYLALQHGIRVANYPLVEEDLHSTHLPRPIRDYADRCFGLVSTPARLSQVRSER
FT                   RPGSTYASLAQCSYELRRAEALYRAHRIPSINSASMSVEEMAAVIMQTRHMSNLA"
     MSAPDSVTET PVFFLAGGTG ISAETLGNLM LNQFPSVRFR RRKIPFITTP EIARQVVAEM        60
     DEAMTDAVTP LVFSTVADEE VRTELVKTKC AFIDLFGSHL DAIERVLHVN ASHNRAGLHG       120
     LGDPRRYEQR MKAIEYAMEH DDGQSLRNLA QAELILVAPS RCGKTPTSMY LALQHGIRVA       180
     NYPLVEEDLH STHLPRPIRD YADRCFGLVS TPARLSQVRS ERRPGSTYAS LAQCSYELRR       240
     AEALYRAHRI PSINSASMSV EEMAAVIMQT RHMSNLA                                277
//

If you have problems or comments...

PBIL Back to PBIL home page