(data stored in ACNUC7421 zone)

EMBL: CP002343.PE16

CP002343.PE16        Location/Qualifiers
FT   CDS             complement(20042..20422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0016"
FT                   /product="transcription factor WhiB"
FT                   /note="InterPro IPR003482; KEGG: kra:Krad_4662
FT                   transcriptional regulatory protein WhiB-like WhiB2; PFAM:
FT                   transcription factor WhiB; SPTR: Regulatory protein; PFAM:
FT                   Transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46578"
FT                   /db_xref="GOA:E6SDX5"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX5"
FT                   /protein_id="ADU46578.1"
FT                   /translation="MRGQVNAGVFLHRYGRADDTINHGDGPSPDELLRAKWMRAGSCRG
FT                   DEKYRWFGQPNTLKSLRAAAICRECPVRQMCLASALVFGEEFGVWGGLNPVERRPLHRR
FT                   LALGETLGSVLRSVLNGERRAA"
     MRGQVNAGVF LHRYGRADDT INHGDGPSPD ELLRAKWMRA GSCRGDEKYR WFGQPNTLKS        60
     LRAAAICREC PVRQMCLASA LVFGEEFGVW GGLNPVERRP LHRRLALGET LGSVLRSVLN       120
     GERRAA                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page