(data stored in ACNUC7421 zone)

EMBL: CP002343.PE162

CP002343.PE162       Location/Qualifiers
FT   CDS             complement(179335..180639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0163"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000878:
FT                   IPR000182; KEGG: tbi:Tbis_1840 GCN5-related
FT                   N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Acetyltransferase (GNAT)
FT                   family; Tetrapyrrole (Corrin/Porphyrin) Methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46724"
FT                   /db_xref="GOA:E6S5Y4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y4"
FT                   /protein_id="ADU46724.1"
FT                   /translation="MTQRIHLVGIGLGDRAHLTGAGVAALDTLDVFVVLEPGAAAQREL
FT                   LAAVLTDPGAHRFIEPTAHPSEPGSVGSPAAYGVGSVSERVTAIVRELGELAPPAATVG
FT                   LLVPGVPALEAAAHELATALADRLGIGVAITPGVGAAQLLAARHGITLGRDGTGVHAIS
FT                   GQHLVDTYQPHDGDAVVVADAELRCLELAELYPDLEVFWGAHLDRDDEVLVSGRLGDLA
FT                   ATLTAARRRAEDASGWLLDAYVVRPSEPSSEVGPPPWPPVERLSDGVLGLRPLTASDWQ
FT                   TVLEENNDEESLRWSLTGPLTEAEARRRAASARRDWVSGRAARFVMVDEATGHPAGAIG
FT                   VLRMGPPDIGLIGYGVLPRFRGRGFTTRALELLAEWAFSATSIVRLELGHKVGNVASGV
FT                   VAARAGFVRESVLTGRLRNVDGTFSDEVTYARVRR"
     MTQRIHLVGI GLGDRAHLTG AGVAALDTLD VFVVLEPGAA AQRELLAAVL TDPGAHRFIE        60
     PTAHPSEPGS VGSPAAYGVG SVSERVTAIV RELGELAPPA ATVGLLVPGV PALEAAAHEL       120
     ATALADRLGI GVAITPGVGA AQLLAARHGI TLGRDGTGVH AISGQHLVDT YQPHDGDAVV       180
     VADAELRCLE LAELYPDLEV FWGAHLDRDD EVLVSGRLGD LAATLTAARR RAEDASGWLL       240
     DAYVVRPSEP SSEVGPPPWP PVERLSDGVL GLRPLTASDW QTVLEENNDE ESLRWSLTGP       300
     LTEAEARRRA ASARRDWVSG RAARFVMVDE ATGHPAGAIG VLRMGPPDIG LIGYGVLPRF       360
     RGRGFTTRAL ELLAEWAFSA TSIVRLELGH KVGNVASGVV AARAGFVRES VLTGRLRNVD       420
     GTFSDEVTYA RVRR                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page