(data stored in ACNUC7421 zone)

EMBL: CP002343.PE165

CP002343.PE165       Location/Qualifiers
FT   CDS             complement(182470..183279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0166"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="COGs: COG1695 transcriptional regulator protein;
FT                   InterPro IPR005149; KEGG: nca:Noca_4612 PadR family
FT                   transcriptional regulator; PFAM: transcriptional regulator
FT                   PadR family protein; SPTR: Transcriptional regulator, PadR
FT                   family; PFAM: Transcriptional regulator PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46727"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y7"
FT                   /protein_id="ADU46727.1"
FT                   /translation="MNSDRNEANEEWGWSDATAGSEGEPGHRGGPSRHGGHRRPGGPGG
FT                   RGPGGPDWLTGFGGWGPEGGPWGGMGRGRPGPPPWIHDLIRQFGGPALGPEQHPRGPRR
FT                   PRARRGDVRAAILDVLAGNEMNGYQLIQEIAERTGGGWKPSPGSVYPTIQQLEDEGLVE
FT                   GRDAEGRRLLRLTDEGRRYVEEHPDEMGATWAPFEPENDAAPDDRASHGFSGTPGGDGL
FT                   MPVVGQVMGAMWQVVTTGTAQQRAEARDILSETRRRLYQLLADGDPE"
     MNSDRNEANE EWGWSDATAG SEGEPGHRGG PSRHGGHRRP GGPGGRGPGG PDWLTGFGGW        60
     GPEGGPWGGM GRGRPGPPPW IHDLIRQFGG PALGPEQHPR GPRRPRARRG DVRAAILDVL       120
     AGNEMNGYQL IQEIAERTGG GWKPSPGSVY PTIQQLEDEG LVEGRDAEGR RLLRLTDEGR       180
     RYVEEHPDEM GATWAPFEPE NDAAPDDRAS HGFSGTPGGD GLMPVVGQVM GAMWQVVTTG       240
     TAQQRAEARD ILSETRRRLY QLLADGDPE                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page