(data stored in ACNUC7421 zone)

EMBL: CP002343.PE166

CP002343.PE166       Location/Qualifiers
FT   CDS             183478..183936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0167"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="InterPro IPR003594; KEGG: tcu:Tcur_0095 putative
FT                   anti-sigma regulatory factor, serine/threonine protein
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   SPTR: Putative regulatory protein; PFAM: Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46728"
FT                   /db_xref="GOA:E6S5Y8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y8"
FT                   /protein_id="ADU46728.1"
FT                   /translation="MPTMQDGSPSTDGGAPQNEKRTVRIPWAPSAAPSIRKTLVADLAS
FT                   REVPGEVVEEAEIVVSELVANAIRHAKPLADGAIRVHWKVKNNVVEVEVTDGGGPTVPR
FT                   PAPPTTWGPGGRGLRIVRSLAHEWGVLDEPNGRTVWASVGGPSRRRSH"
     MPTMQDGSPS TDGGAPQNEK RTVRIPWAPS AAPSIRKTLV ADLASREVPG EVVEEAEIVV        60
     SELVANAIRH AKPLADGAIR VHWKVKNNVV EVEVTDGGGP TVPRPAPPTT WGPGGRGLRI       120
     VRSLAHEWGV LDEPNGRTVW ASVGGPSRRR SH                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page