(data stored in ACNUC7421 zone)

EMBL: CP002343.PE17

CP002343.PE17        Location/Qualifiers
FT   CDS             complement(20419..21846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0017"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="COGs: COG1674 DNA segregation ATPase FtsK/SpoIIIE
FT                   and related protein; InterPro IPR002543: IPR003593:
FT                   IPR000408; KEGG: fra:Francci3_4272 cell
FT                   divisionFtsK/SpoIIIE; PFAM: cell divisionFtsK/SpoIIIE;
FT                   SMART: AAA ATPase; SPTR: Cell divisionFtsK/SpoIIIE; PFAM:
FT                   FtsK/SpoIIIE family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46579"
FT                   /db_xref="GOA:E6SDX6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX6"
FT                   /protein_id="ADU46579.1"
FT                   /translation="MSTRGQARSALFDSDDLLAVALEAVVLGVLGVFRALWAALVMAVR
FT                   FPAAAVPLLLVVAAGVLLGSKGVALVLVMLAALLGAWRLKAPSSFSRHVSDRSAFMVRN
FT                   AIYRLRWTGVARRTDLVAHDGRLGRGRDPELVALLRVRPTTAGSDRLLLRLPTGLTPDD
FT                   VAGKADAIAHAFRSEAARIHPDRPGRVWLELRRADQLAAPILPLPQSDKLDLAALPVGH
FT                   AEDGSTWHLRLAGTHLLIAGATGAGKSSVLWSMLRALTRGIRQGLVEVWAVDPKGGMEL
FT                   RPGRALFARFEDSTPEDMCVVLEDLVVLKDSRAKQLAESGQRSHVAGAGSPHIIALLDE
FT                   LATLTAFADRAVTRRIDTALGLLLTQGRACGITVVAAVQDPGKDIVGWRDLFPTRVAMR
FT                   LDNPLQVAMVLGDGAREMGAKADEISELTPGVAFVRVEGTRQIKRVRAAYVNDNAIAEL
FT                   AAQISVSDEQNQREEVQ"
     MSTRGQARSA LFDSDDLLAV ALEAVVLGVL GVFRALWAAL VMAVRFPAAA VPLLLVVAAG        60
     VLLGSKGVAL VLVMLAALLG AWRLKAPSSF SRHVSDRSAF MVRNAIYRLR WTGVARRTDL       120
     VAHDGRLGRG RDPELVALLR VRPTTAGSDR LLLRLPTGLT PDDVAGKADA IAHAFRSEAA       180
     RIHPDRPGRV WLELRRADQL AAPILPLPQS DKLDLAALPV GHAEDGSTWH LRLAGTHLLI       240
     AGATGAGKSS VLWSMLRALT RGIRQGLVEV WAVDPKGGME LRPGRALFAR FEDSTPEDMC       300
     VVLEDLVVLK DSRAKQLAES GQRSHVAGAG SPHIIALLDE LATLTAFADR AVTRRIDTAL       360
     GLLLTQGRAC GITVVAAVQD PGKDIVGWRD LFPTRVAMRL DNPLQVAMVL GDGAREMGAK       420
     ADEISELTPG VAFVRVEGTR QIKRVRAAYV NDNAIAELAA QISVSDEQNQ REEVQ            475
//

If you have problems or comments...

PBIL Back to PBIL home page