(data stored in ACNUC7421 zone)

EMBL: CP002343.PE170

CP002343.PE170       Location/Qualifiers
FT   CDS             188121..188705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_2106 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46732"
FT                   /db_xref="GOA:E6S5Z2"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z2"
FT                   /protein_id="ADU46732.1"
FT                   /translation="MGGGHSLERERASPAAGLPLRIVEEPTLAVVAIGAAVVAVLALAL
FT                   AVGAQLRLARIRRDFRALAGDGSTDIARVAAGQNHRIDRIATEVSRLREQVRTAEDDVR
FT                   QSLRHVAVVRYDAFGDMGGRLSFSAAIVDDLGDGIVISSIHARSESRTYAKGVVGGRSS
FT                   ITLSPEEQQALAAATRGEPRSVHPSSQKDVP"
     MGGGHSLERE RASPAAGLPL RIVEEPTLAV VAIGAAVVAV LALALAVGAQ LRLARIRRDF        60
     RALAGDGSTD IARVAAGQNH RIDRIATEVS RLREQVRTAE DDVRQSLRHV AVVRYDAFGD       120
     MGGRLSFSAA IVDDLGDGIV ISSIHARSES RTYAKGVVGG RSSITLSPEE QQALAAATRG       180
     EPRSVHPSSQ KDVP                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page