(data stored in SCRATCH zone)

EMBL: CP002343.PE172

CP002343.PE172       Location/Qualifiers
FT   CDS             189978..190367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4153 outer membrane efflux protein;
FT                   SPTR: Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46734"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z4"
FT                   /protein_id="ADU46734.1"
FT                   /translation="MTDYVPGRLLVAGFPRTDDAPWLVELRLALAEVGLTFRLTAASRR
FT                   RTRRLRSTGGRALELLDAMWVSTVVLEPLVGPGVERPEIPQAWWVIERLRSRRPTLADR
FT                   LSLVETRRPATMGTEPLGLVIGVPA"
     MTDYVPGRLL VAGFPRTDDA PWLVELRLAL AEVGLTFRLT AASRRRTRRL RSTGGRALEL        60
     LDAMWVSTVV LEPLVGPGVE RPEIPQAWWV IERLRSRRPT LADRLSLVET RRPATMGTEP       120
     LGLVIGVPA                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page