(data stored in SCRATCH zone)

EMBL: CP002343.PE173

CP002343.PE173       Location/Qualifiers
FT   CDS             complement(190383..191543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0174"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG1228 Imidazolonepropionase and related
FT                   amidohydrolase; InterPro IPR006680; KEGG: mbt:JTY_0076
FT                   hypothetical protein; PFAM: amidohydrolase; SPTR: Putative
FT                   uncharacterized protein Mb0076; PFAM: Amidohydrolase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46735"
FT                   /db_xref="GOA:E6S5Z5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z5"
FT                   /protein_id="ADU46735.1"
FT                   /translation="MHVIRADQVFDGDGFLGRTDVVLDGPNVVAVQEPTEYASEVVVED
FT                   LGAVTVLPGLVDAHQHLTWDAADPLAWHAEHDDSALLEQGRTNARRALSAGITTIRDLG
FT                   SRGRVALQLRDETARSPLAGPTLLVAGPALTTPGGHCWFLGGACTDADELVKAVARLDE
FT                   AGVDVIKVMATGGNITPGSAPHESQFRLPELKAVVDAAHAAGLPVAAHAHGTGGVSDAT
FT                   AAGVDTIEHCSFFTEDGIAEDPALIQRLAESGVAVSLTAGTPPGTTPLPAVAARMPALL
FT                   AHIRGLREAGVRCILGTDAGIGPGKPHDVLPLAVVQGVELVGIPVTEALAMCTSRAAEA
FT                   IGLGRRAGRLRAGGTADVLVVTGLVDEDPAALVRPARVLRGGVRVA"
     MHVIRADQVF DGDGFLGRTD VVLDGPNVVA VQEPTEYASE VVVEDLGAVT VLPGLVDAHQ        60
     HLTWDAADPL AWHAEHDDSA LLEQGRTNAR RALSAGITTI RDLGSRGRVA LQLRDETARS       120
     PLAGPTLLVA GPALTTPGGH CWFLGGACTD ADELVKAVAR LDEAGVDVIK VMATGGNITP       180
     GSAPHESQFR LPELKAVVDA AHAAGLPVAA HAHGTGGVSD ATAAGVDTIE HCSFFTEDGI       240
     AEDPALIQRL AESGVAVSLT AGTPPGTTPL PAVAARMPAL LAHIRGLREA GVRCILGTDA       300
     GIGPGKPHDV LPLAVVQGVE LVGIPVTEAL AMCTSRAAEA IGLGRRAGRL RAGGTADVLV       360
     VTGLVDEDPA ALVRPARVLR GGVRVA                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page