(data stored in ACNUC7421 zone)

EMBL: CP002343.PE174

CP002343.PE174       Location/Qualifiers
FT   CDS             191685..192566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0175"
FT                   /product="iron permease FTR1"
FT                   /note="COGs: COG0672 High-affinity Fe2+/Pb2+ permease;
FT                   InterPro IPR004923; KEGG: amd:AMED_8204 high-affinity iron
FT                   transporter; PFAM: iron permease FTR1; SPTR: Putative
FT                   membrane protein; PFAM: Iron permease FTR1 family; TIGRFAM:
FT                   FTR1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46736"
FT                   /db_xref="GOA:E6S5Z6"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z6"
FT                   /protein_id="ADU46736.1"
FT                   /translation="MLVSNALIGLREGLEAALVVVILVAFLVKTGRHWALRWVWLGVGT
FT                   AVALSVVLGAVLTYGTSRLSFEQQELIGGFASIIAVVFVTGMVFWMRSAARTISGELRG
FT                   RLDRALDLGPLAVALVGFLGVGREGLETAIFFYATTQAAGAGNSQPLIGWVLGLTGAVA
FT                   LGGLIYRGAVRINLTAFFRWTGSLLVVVAAGILAYGLHDLQEAGLLPGLGAVAFDISSV
FT                   IAHDGWIGNLLRGIFNFTPQPTVVQAVAWSLYVAVILTLFLRPQRTSQPSEPAPSAPAD
FT                   LAARPSEPAPAN"
     MLVSNALIGL REGLEAALVV VILVAFLVKT GRHWALRWVW LGVGTAVALS VVLGAVLTYG        60
     TSRLSFEQQE LIGGFASIIA VVFVTGMVFW MRSAARTISG ELRGRLDRAL DLGPLAVALV       120
     GFLGVGREGL ETAIFFYATT QAAGAGNSQP LIGWVLGLTG AVALGGLIYR GAVRINLTAF       180
     FRWTGSLLVV VAAGILAYGL HDLQEAGLLP GLGAVAFDIS SVIAHDGWIG NLLRGIFNFT       240
     PQPTVVQAVA WSLYVAVILT LFLRPQRTSQ PSEPAPSAPA DLAARPSEPA PAN              293
//

If you have problems or comments...

PBIL Back to PBIL home page