(data stored in ACNUC7421 zone)

EMBL: CP002343.PE176

CP002343.PE176       Location/Qualifiers
FT   CDS             194894..195451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_3194 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Mycothiol
FT                   maleylpyruvate isomerase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46738"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z8"
FT                   /protein_id="ADU46738.1"
FT                   /translation="MSDARVQPSDPGPAAPDTADWTWVLTRPCLDCGFDPADVRPDGVS
FT                   EILLDARRRFTRVLERDDVALRPAEGVWSPLEYSAHVRDVCDVMRGRLEQILAAGGATV
FT                   QFANWDQDAAAVEKSYWRSDPTVLRRELDAAFDAAAAAFARPTPGQWSWPGLRSNGSPF
FT                   TVDTLGRYFVHDVLHHLWDVRG"
     MSDARVQPSD PGPAAPDTAD WTWVLTRPCL DCGFDPADVR PDGVSEILLD ARRRFTRVLE        60
     RDDVALRPAE GVWSPLEYSA HVRDVCDVMR GRLEQILAAG GATVQFANWD QDAAAVEKSY       120
     WRSDPTVLRR ELDAAFDAAA AAFARPTPGQ WSWPGLRSNG SPFTVDTLGR YFVHDVLHHL       180
     WDVRG                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page