(data stored in ACNUC7421 zone)

EMBL: CP002343.PE177

CP002343.PE177       Location/Qualifiers
FT   CDS             195448..196506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0180"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683: IPR004104; KEGG: cfl:Cfla_0574
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: Oxidoreductase domain
FT                   protein; PFAM: Oxidoreductase family, NAD-binding Rossmann
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46739"
FT                   /db_xref="GOA:E6S5Z9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z9"
FT                   /protein_id="ADU46739.1"
FT                   /translation="MSPVAVGGNAHALPEARVPDPREAPPIRWGILAPGGIANEFAAAV
FT                   TAGTASTVVAVGSRSEQRARDFADRHHIPRAFGSYEALVADEAVDAVYVASPHSEHHDH
FT                   ALLALEAGKPVLVEKAFTRNVTEARAVIRAGADRGLLVAEAMWARYLPHYDVVRQVLDG
FT                   GVLGDLVLLRADHSQLLHPNGPERLARPELAGGALLDLGVYPVSFADHLLGPPASVAAR
FT                   GSLTECGVDATVGIVLAYVSGAVAVLTCSMLARTPCAAEIIGTEARLELDGPFYAPTAV
FT                   RLLSPAGEVLAERPGTLPGPLRGFSYQAAEFARCLSAGSRECPAMPHAATLRVMSTMDE
FT                   IRAQVGVRYPGE"
     MSPVAVGGNA HALPEARVPD PREAPPIRWG ILAPGGIANE FAAAVTAGTA STVVAVGSRS        60
     EQRARDFADR HHIPRAFGSY EALVADEAVD AVYVASPHSE HHDHALLALE AGKPVLVEKA       120
     FTRNVTEARA VIRAGADRGL LVAEAMWARY LPHYDVVRQV LDGGVLGDLV LLRADHSQLL       180
     HPNGPERLAR PELAGGALLD LGVYPVSFAD HLLGPPASVA ARGSLTECGV DATVGIVLAY       240
     VSGAVAVLTC SMLARTPCAA EIIGTEARLE LDGPFYAPTA VRLLSPAGEV LAERPGTLPG       300
     PLRGFSYQAA EFARCLSAGS RECPAMPHAA TLRVMSTMDE IRAQVGVRYP GE               352
//

If you have problems or comments...

PBIL Back to PBIL home page