(data stored in ACNUC7421 zone)

EMBL: CP002343.PE178

CP002343.PE178       Location/Qualifiers
FT   CDS             complement(196555..197370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0181"
FT                   /product="pentapeptide repeat protein"
FT                   /note="COGs: COG1357 Uncharacterized low-complexity
FT                   protein; InterPro IPR001646; KEGG: kfl:Kfla_5660
FT                   pentapeptide repeat protein; PFAM: pentapeptide repeat
FT                   protein; SPTR: Pentapeptide repeat protein; PFAM: Protein
FT                   of unknown function (DUF664); Pentapeptide repeats (8
FT                   copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46740"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6S600"
FT                   /protein_id="ADU46740.1"
FT                   /translation="MERFHDADLSGSEFEHVRLVGAQLRRVDLTGARFQTVDLTGAAFR
FT                   DVDFSGAQLRGVLVREADVSGEILSLTVNGVDVVPLVEAELDRRDPERPTLLRPTDPAG
FT                   FREAWAINERRWAGTVERARLLPAEALYQSVDGEWSFIETLRHLAFATDSWVSRAIQGD
FT                   PSPWHPLELPWDEMPDTPGVPRDRAARPSLDEALALRHDGMARVGRLLEGLTDESLAAQ
FT                   TTPVDGPGWPEPRSYPVRECLLTVLNEEYHHRLFAERDLSVLEAGDSGT"
     MERFHDADLS GSEFEHVRLV GAQLRRVDLT GARFQTVDLT GAAFRDVDFS GAQLRGVLVR        60
     EADVSGEILS LTVNGVDVVP LVEAELDRRD PERPTLLRPT DPAGFREAWA INERRWAGTV       120
     ERARLLPAEA LYQSVDGEWS FIETLRHLAF ATDSWVSRAI QGDPSPWHPL ELPWDEMPDT       180
     PGVPRDRAAR PSLDEALALR HDGMARVGRL LEGLTDESLA AQTTPVDGPG WPEPRSYPVR       240
     ECLLTVLNEE YHHRLFAERD LSVLEAGDSG T                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page