(data stored in ACNUC7421 zone)

EMBL: CP002343.PE179

CP002343.PE179       Location/Qualifiers
FT   CDS             complement(197444..198877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0182"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="COGs: COG0364 Glucose-6-phosphate 1-dehydrogenase;
FT                   InterPro IPR001282: IPR019796; KEGG: mjl:Mjls_5357
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase; PRIAM:
FT                   Glucose-6-phosphate dehydrogenase; SPTR:
FT                   Glucose-6-phosphate 1-dehydrogenase; TIGRFAM:
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   Glucose-6-phosphate dehydrogenase, C-terminal domain;
FT                   Glucose-6-phosphate dehydrogenase, NAD binding domain;
FT                   TIGRFAM: glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46741"
FT                   /db_xref="GOA:E6S601"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S601"
FT                   /protein_id="ADU46741.1"
FT                   /translation="MPATTVVLFGATGDLAKRKLLPGMLHLHESQLLEGLRIVATSLED
FT                   LTRDEFLDLVVDSVRTHSSRDVTDEDLREFADRIHWVPGSGGPAALRQAVLDSEEILGS
FT                   GARRLHYLSVPPAAALAVVRQIAAAGLVERSRIIMEKPFGTDLASARKLNAELHEVFAE
FT                   EQIFRIDHFLGKEPAQNILAFRFANGLFEPIWHRNHIDHIQIDVPETLGLEQRADFYEA
FT                   TGAYRDMVVTHLFQVLAFTAMEPPTSLEPSAITEEKSKVFRSMLTIDPHDVVRGQYVGY
FT                   RDEEGVAPDSETETFVALKCFVDNWRWAGVPFFLRTGKRMSEGARIISIAFKEPPRTMF
FT                   PPSSGVGDDGPDHLTFDLADRARMSLSFYGKRPGPGMALDKLSMQFSMQDTDWAGAALE
FT                   AYERLIYDAARGDATLFTRAEGIERLWEISQPLLDNPPPVRPYQQGTWGPNQIHQLVAP
FT                   FAWRLPFERPWRDPNLMGA"
     MPATTVVLFG ATGDLAKRKL LPGMLHLHES QLLEGLRIVA TSLEDLTRDE FLDLVVDSVR        60
     THSSRDVTDE DLREFADRIH WVPGSGGPAA LRQAVLDSEE ILGSGARRLH YLSVPPAAAL       120
     AVVRQIAAAG LVERSRIIME KPFGTDLASA RKLNAELHEV FAEEQIFRID HFLGKEPAQN       180
     ILAFRFANGL FEPIWHRNHI DHIQIDVPET LGLEQRADFY EATGAYRDMV VTHLFQVLAF       240
     TAMEPPTSLE PSAITEEKSK VFRSMLTIDP HDVVRGQYVG YRDEEGVAPD SETETFVALK       300
     CFVDNWRWAG VPFFLRTGKR MSEGARIISI AFKEPPRTMF PPSSGVGDDG PDHLTFDLAD       360
     RARMSLSFYG KRPGPGMALD KLSMQFSMQD TDWAGAALEA YERLIYDAAR GDATLFTRAE       420
     GIERLWEISQ PLLDNPPPVR PYQQGTWGPN QIHQLVAPFA WRLPFERPWR DPNLMGA          477
//

If you have problems or comments...

PBIL Back to PBIL home page