(data stored in ACNUC7421 zone)

EMBL: CP002343.PE181

CP002343.PE181       Location/Qualifiers
FT   CDS             200356..201291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0184"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593: IPR017871;
FT                   KEGG: nca:Noca_4497 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46743"
FT                   /db_xref="GOA:E6S603"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S603"
FT                   /protein_id="ADU46743.1"
FT                   /translation="MCRAVADRHRGPMIHVDRLTKRYGPFTAVDDISFEVRPGQVTGFL
FT                   GPNGAGKSTAMRIMAGLTPATSGTATVLGRAYGHLPNPGRHVGVLLDASAQHAGRTGRE
FT                   ILSLSAIMMGVDRRRVDEMLDLVGLTDKEAARRVRNYSLGMRQRLGIANALLGDPEVLI
FT                   LDEPANGLDPAGIRWMRDLLRGYANQGGTVLLSSHLLNEIERVADEIIVIGHGRIVAQG
FT                   TKDALLSGAGTYVRSTDDAGLAAALALEDISVSPAATGGLHVDAEPMTVGQVAAASGVV
FT                   LVELRSGDSRGLEEMFLELTAATAREEVAA"
     MCRAVADRHR GPMIHVDRLT KRYGPFTAVD DISFEVRPGQ VTGFLGPNGA GKSTAMRIMA        60
     GLTPATSGTA TVLGRAYGHL PNPGRHVGVL LDASAQHAGR TGREILSLSA IMMGVDRRRV       120
     DEMLDLVGLT DKEAARRVRN YSLGMRQRLG IANALLGDPE VLILDEPANG LDPAGIRWMR       180
     DLLRGYANQG GTVLLSSHLL NEIERVADEI IVIGHGRIVA QGTKDALLSG AGTYVRSTDD       240
     AGLAAALALE DISVSPAATG GLHVDAEPMT VGQVAAASGV VLVELRSGDS RGLEEMFLEL       300
     TAATAREEVA A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page