(data stored in ACNUC7421 zone)

EMBL: CP002343.PE182

CP002343.PE182       Location/Qualifiers
FT   CDS             201288..202127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_0762 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46744"
FT                   /db_xref="GOA:E6S604"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E6S604"
FT                   /protein_id="ADU46744.1"
FT                   /translation="MSTTVTEPVASPTAESPLPATARIPERIPGERPTAAIPFSRLLLV
FT                   ELRKMVDTRAGRWLLIGIGAVIALALTIMFFNESGHHPFAAYLQATTMPMAVILPVVGI
FT                   LAVTSEWSQRTGLVTYTLEPRRARVTWAKFLGAMLAGVAAIALSLALAAVMHQGAITLR
FT                   GYSGDWSLDNKALLGASLYVLLGIAQGVGFGMLLRNTPAAIVLYFVLPIAWGILGDLVS
FT                   WLDGAASWLDMNRTMNPLFLVESMTGEQWAQLATSVGVWVALPVALGIWMLHRAEVK"
     MSTTVTEPVA SPTAESPLPA TARIPERIPG ERPTAAIPFS RLLLVELRKM VDTRAGRWLL        60
     IGIGAVIALA LTIMFFNESG HHPFAAYLQA TTMPMAVILP VVGILAVTSE WSQRTGLVTY       120
     TLEPRRARVT WAKFLGAMLA GVAAIALSLA LAAVMHQGAI TLRGYSGDWS LDNKALLGAS       180
     LYVLLGIAQG VGFGMLLRNT PAAIVLYFVL PIAWGILGDL VSWLDGAASW LDMNRTMNPL       240
     FLVESMTGEQ WAQLATSVGV WVALPVALGI WMLHRAEVK                              279
//

If you have problems or comments...

PBIL Back to PBIL home page