(data stored in ACNUC7421 zone)

EMBL: CP002343.PE184

CP002343.PE184       Location/Qualifiers
FT   CDS             complement(202985..203749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0187"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339: IPR012809; KEGG: nca:Noca_1329 cobalt ABC
FT                   transporter, inner membrane subunit CbiQ; PFAM: cobalt
FT                   transport protein; SPTR: Cobalt ABC transporter, inner
FT                   membrane subunit CbiQ; TIGRFAM: cobalt ABC transporter,
FT                   inner membrane subunit CbiQ; PFAM: Cobalt transport
FT                   protein; TIGRFAM: cobalt ABC transporter, permease protein
FT                   CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46746"
FT                   /db_xref="GOA:E6S606"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:E6S606"
FT                   /protein_id="ADU46746.1"
FT                   /translation="MGAPHGHALHFHGHSPVHRLPAHVKIVVLVGYVLAVVATPRGVFW
FT                   PYAAHLLALAGAVAVSRVPLAHLAKRLVIEVPFVVFALVLPFVATGPRTAVGPVEISQP
FT                   GLEAAAALLAKGTLGVLASLLLAATTEPRDIVAGFEKLRLPQSLVQIMSFMLRYTEVVA
FT                   ADLGRMRVARESRGFRARSVRQWPALGATLGALFIRSYERGERVHLAMLSRGYTGRLPT
FT                   LRPLTATGSQWAASGLLPIACGLVSAAAVLAG"
     MGAPHGHALH FHGHSPVHRL PAHVKIVVLV GYVLAVVATP RGVFWPYAAH LLALAGAVAV        60
     SRVPLAHLAK RLVIEVPFVV FALVLPFVAT GPRTAVGPVE ISQPGLEAAA ALLAKGTLGV       120
     LASLLLAATT EPRDIVAGFE KLRLPQSLVQ IMSFMLRYTE VVAADLGRMR VARESRGFRA       180
     RSVRQWPALG ATLGALFIRS YERGERVHLA MLSRGYTGRL PTLRPLTATG SQWAASGLLP       240
     IACGLVSAAA VLAG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page