(data stored in SCRATCH zone)

EMBL: CP002343.PE186

CP002343.PE186       Location/Qualifiers
FT   CDS             205231..206556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0190"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COGs: COG0172 Seryl-tRNA synthetase;
FT                   InterProIPR015866: IPR002314: IPR002317: IPR018156: IPR
FT                   006195; KEGG: kra:Krad_0249 seryl-tRNA synthetase; PFAM:
FT                   tRNA synthetase class II (G H P and S); Seryl-tRNA
FT                   synthetase, class IIa-like; PRIAM: Serine--tRNA ligase;
FT                   SPTR: Seryl-tRNA synthetase; TIGRFAM: seryl-tRNA
FT                   synthetase; PFAM: Seryl-tRNA synthetase N-terminal domain;
FT                   tRNA synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46748"
FT                   /db_xref="GOA:E6S608"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E6S608"
FT                   /protein_id="ADU46748.1"
FT                   /translation="MIDIKLLRDEPDRVRASQLARGEDPGIVDAILAADERRRSSLGEF
FT                   ETLRAEQKAVSKDVGAAMGAFQRAKKAGAPDAAHLESVAHAARAKAAHLSDQVKALESN
FT                   ADEAGAELERLLRKVGNVIIDGVPTGGEDDYVVVETIGTPRDFASEGFEPLDHLALGER
FT                   LGAIDMERGAKVGGARFYYLTGVGALLELALLNMAMAQATAAGFTAMITPTMARPEIML
FT                   GAGFIDAHADEVYRLEADDLYLTGTSEVALAGFHADEIIDLSAGPKRYAGWSACYRREA
FT                   GSHGKDTRGIIRVHQFHKVEMFSYCRPEDAEAEHGRLLDWEREMLAKIEVPYRIIDTAA
FT                   GDLGSPAARKFDCEAWVPTQGKYRELTSTSNCTTYQARRLNTRERDPNGSGTRTVATLN
FT                   GTLGTTRWLVAILENHQQPDGSVVVPEALRPFLGMDVLKPIA"
     MIDIKLLRDE PDRVRASQLA RGEDPGIVDA ILAADERRRS SLGEFETLRA EQKAVSKDVG        60
     AAMGAFQRAK KAGAPDAAHL ESVAHAARAK AAHLSDQVKA LESNADEAGA ELERLLRKVG       120
     NVIIDGVPTG GEDDYVVVET IGTPRDFASE GFEPLDHLAL GERLGAIDME RGAKVGGARF       180
     YYLTGVGALL ELALLNMAMA QATAAGFTAM ITPTMARPEI MLGAGFIDAH ADEVYRLEAD       240
     DLYLTGTSEV ALAGFHADEI IDLSAGPKRY AGWSACYRRE AGSHGKDTRG IIRVHQFHKV       300
     EMFSYCRPED AEAEHGRLLD WEREMLAKIE VPYRIIDTAA GDLGSPAARK FDCEAWVPTQ       360
     GKYRELTSTS NCTTYQARRL NTRERDPNGS GTRTVATLNG TLGTTRWLVA ILENHQQPDG       420
     SVVVPEALRP FLGMDVLKPI A                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page