(data stored in ACNUC7421 zone)

EMBL: CP002343.PE187

CP002343.PE187       Location/Qualifiers
FT   CDS             206637..208019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0191"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR001327: IPR004099: IPR013027: IPR000815; KEGG:
FT                   sco:SCO3443 pyridine nucleotide-disulphide oxidoreductase;
FT                   PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: Putative
FT                   pyridine nucleotide-disulphide oxidoreductase; PFAM:
FT                   Pyridine nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46749"
FT                   /db_xref="GOA:E6S609"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S609"
FT                   /protein_id="ADU46749.1"
FT                   /translation="MESFDIIVVGMGPGGEHVANTLAERGLRVLGVDHGLVGGECPYWG
FT                   CIPTKMMVRAADALAEARRVDGLAGSVADVTPDWSLVARRIRDEATDGWDDQVAVERFT
FT                   QKGGTFLRGTGRVVGPGRVDVDGKPYAAGRGIVVNVGSRAATPPIEGLEGVPFWTNREF
FT                   AEATALPGSLVVLGGGAIGCELAQVAARFGTTVTVVESAPRLLSPEEPEASERIATVFE
FT                   REGITVHVGSAAATVAASPTPGEADQVEVTLEDGTVLRAERLLVATGRRTDPGAVGLGS
FT                   VGVAADARVAPTDEWCRVAPGVWAVGDITGKGAFTHVSMYQAAIVVRDVLGEAGPPADY
FT                   RAVPRVTFTDPEVATVGLTEAQARDQGVEVRTGFTALGSTTRGWIHGVGGDGFIKLVAD
FT                   PGRGLLVGATVMGPAAGEVMGALAVAVHAEVPLDRLRSMIHAYPTFHRGIEDALADLDQ
FT                   RS"
     MESFDIIVVG MGPGGEHVAN TLAERGLRVL GVDHGLVGGE CPYWGCIPTK MMVRAADALA        60
     EARRVDGLAG SVADVTPDWS LVARRIRDEA TDGWDDQVAV ERFTQKGGTF LRGTGRVVGP       120
     GRVDVDGKPY AAGRGIVVNV GSRAATPPIE GLEGVPFWTN REFAEATALP GSLVVLGGGA       180
     IGCELAQVAA RFGTTVTVVE SAPRLLSPEE PEASERIATV FEREGITVHV GSAAATVAAS       240
     PTPGEADQVE VTLEDGTVLR AERLLVATGR RTDPGAVGLG SVGVAADARV APTDEWCRVA       300
     PGVWAVGDIT GKGAFTHVSM YQAAIVVRDV LGEAGPPADY RAVPRVTFTD PEVATVGLTE       360
     AQARDQGVEV RTGFTALGST TRGWIHGVGG DGFIKLVADP GRGLLVGATV MGPAAGEVMG       420
     ALAVAVHAEV PLDRLRSMIH AYPTFHRGIE DALADLDQRS                             460
//

If you have problems or comments...

PBIL Back to PBIL home page