(data stored in ACNUC7421 zone)

EMBL: CP002343.PE188

CP002343.PE188       Location/Qualifiers
FT   CDS             208086..209039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0192"
FT                   /product="2-keto-myo-inositol dehydratase"
FT                   /EC_number="4.2.1.44"
FT                   /note="COGs: COG1082 Sugar phosphate isomerase/epimerase;
FT                   InterPro IPR012307; KEGG: kfl:Kfla_1685 myo-inosose-2
FT                   dehydratase; PFAM: Xylose isomerase domain-containing
FT                   protein TIM barrel; PRIAM: Myo-inosose-2 dehydratase; SPTR:
FT                   Putative myo-inositol catabolism protein; PFAM: Xylose
FT                   isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46750"
FT                   /db_xref="GOA:E6S610"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E6S610"
FT                   /protein_id="ADU46750.1"
FT                   /translation="MTGQQQDEPSRVVHPHHLGARPLAERIASAPISWGVSEVPGWGWQ
FT                   FDPHTVLAQMAEIGLAATELGPDGFLPDAPADRARLLGAAGLEAAGQLVSVVLHDATVD
FT                   PLAALEPTMDALVATEATTLVVVAATGVAEDATRPDLDEAAWATLLRNLDRLEDAARSR
FT                   GLVAAVHASADTVVQSLVELQRVIDGSRIGVCLDTGHLALVGDDPLSLALARPGRIVHV
FT                   HLKDVRAAVAERVRSGELSLVEAVRAGLHPPLGQGDLDIAAIVSALEDAGYDGWYVLEQ
FT                   DVVLDEDPGAPGPARQVEQSLDHLLGLAAQWSGVGA"
     MTGQQQDEPS RVVHPHHLGA RPLAERIASA PISWGVSEVP GWGWQFDPHT VLAQMAEIGL        60
     AATELGPDGF LPDAPADRAR LLGAAGLEAA GQLVSVVLHD ATVDPLAALE PTMDALVATE       120
     ATTLVVVAAT GVAEDATRPD LDEAAWATLL RNLDRLEDAA RSRGLVAAVH ASADTVVQSL       180
     VELQRVIDGS RIGVCLDTGH LALVGDDPLS LALARPGRIV HVHLKDVRAA VAERVRSGEL       240
     SLVEAVRAGL HPPLGQGDLD IAAIVSALED AGYDGWYVLE QDVVLDEDPG APGPARQVEQ       300
     SLDHLLGLAA QWSGVGA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page