(data stored in SCRATCH zone)

EMBL: CP002343.PE194

CP002343.PE194       Location/Qualifiers
FT   CDS             212782..214089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0198"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="COGs: COG4941 RNA polymerase sigma factor containing
FT                   a TPR repeat domain; InterPro IPR007627: IPR013249:
FT                   IPR014284; KEGG: cwo:Cwoe_0348 putative RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily; PFAM: sigma-70 region 2
FT                   domain protein; Sigma-70 region 4 type 2; SPTR: Putative
FT                   RNA polymerase, sigma-24 subunit, ECF subfamily; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70, region 4; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46756"
FT                   /db_xref="GOA:E6S616"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6S616"
FT                   /protein_id="ADU46756.1"
FT                   /translation="MTPPAPPVTDPDADSDVVRRTLEAVWRMETAKVTAVVARVVGDIG
FT                   LAEDLAQDAFLQALEQWPRDGLPDKPGAWLTATARRRAIDRIRRDVNLRDKLQQVGHAE
FT                   ELRAADLAEAGFDRALEDIDDDVLGLVFAACHPVLTAQARISLTLRMIGGLTTREIARA
FT                   FLTTESTIGQRISRAKKALRADGVTIEVPSGADLPPRLASVLEVVYLIFNEGYAATSGR
FT                   DWVRGDLMEEAIRLGRVLAALAPQEPEVHGLVALMEIQASRTRARMAADGSPVLLLDQD
FT                   RTRWDWSLIRHALGALDRATQLSGIPGPYVLQAAIAACHARARTPDETDWARIVTLYDE
FT                   LARVRPSPVVDLNRAVAMAYAAGPGPALAVVDRLVESGSLADYHLLPSVRGDLLRKLGR
FT                   EEEAREEFRRAAAMTDNAAERRLLLERAGDDGPVDP"
     MTPPAPPVTD PDADSDVVRR TLEAVWRMET AKVTAVVARV VGDIGLAEDL AQDAFLQALE        60
     QWPRDGLPDK PGAWLTATAR RRAIDRIRRD VNLRDKLQQV GHAEELRAAD LAEAGFDRAL       120
     EDIDDDVLGL VFAACHPVLT AQARISLTLR MIGGLTTREI ARAFLTTEST IGQRISRAKK       180
     ALRADGVTIE VPSGADLPPR LASVLEVVYL IFNEGYAATS GRDWVRGDLM EEAIRLGRVL       240
     AALAPQEPEV HGLVALMEIQ ASRTRARMAA DGSPVLLLDQ DRTRWDWSLI RHALGALDRA       300
     TQLSGIPGPY VLQAAIAACH ARARTPDETD WARIVTLYDE LARVRPSPVV DLNRAVAMAY       360
     AAGPGPALAV VDRLVESGSL ADYHLLPSVR GDLLRKLGRE EEAREEFRRA AAMTDNAAER       420
     RLLLERAGDD GPVDP                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page