(data stored in ACNUC7421 zone)

EMBL: CP002343.PE195

CP002343.PE195       Location/Qualifiers
FT   CDS             214168..215091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0248 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uracil DNA
FT                   glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46757"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E6S617"
FT                   /protein_id="ADU46757.1"
FT                   /translation="MVTHRSCPGYVDEPFASLVADYPGAEAYPPGDFRVEWGPVFHRGR
FT                   LDGSARVLVIGQDPATHEAISRRVLVGEAGQRVQGLLARLGITHSYVMLNVYLYSVFGQ
FT                   AAGYRHVKDPDIVDYRHRWLDAVLLDSASPSVTPSVTPSVTPSVTPSVTPSVASSGVTA
FT                   VIALGTLAKRAFGLWEDSSPEREARSRRLHLAAVRHPTYAEGSARASGQPLEDTTAAQL
FT                   ADWSAHLPALGAAVSPEVTPNLRSYGESWTERDLVAIPEQDLPPGAPAWWRAVDAWAVR
FT                   DGADAQEKRATIRVAVPKGARSWPTL"
     MVTHRSCPGY VDEPFASLVA DYPGAEAYPP GDFRVEWGPV FHRGRLDGSA RVLVIGQDPA        60
     THEAISRRVL VGEAGQRVQG LLARLGITHS YVMLNVYLYS VFGQAAGYRH VKDPDIVDYR       120
     HRWLDAVLLD SASPSVTPSV TPSVTPSVTP SVTPSVASSG VTAVIALGTL AKRAFGLWED       180
     SSPEREARSR RLHLAAVRHP TYAEGSARAS GQPLEDTTAA QLADWSAHLP ALGAAVSPEV       240
     TPNLRSYGES WTERDLVAIP EQDLPPGAPA WWRAVDAWAV RDGADAQEKR ATIRVAVPKG       300
     ARSWPTL                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page