(data stored in ACNUC7421 zone)

EMBL: CP002343.PE196

CP002343.PE196       Location/Qualifiers
FT   CDS             215076..216473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0200"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680; KEGG:
FT                   bja:blr0249 hypothetical protein; PFAM: amidohydrolase;
FT                   SPTR: Amidohydrolase; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46758"
FT                   /db_xref="GOA:E6S618"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6S618"
FT                   /protein_id="ADU46758.1"
FT                   /translation="MADPLRTGPAPGRVTFEEAYSRGITDELPPPPRRARALPPTPFAL
FT                   RGAVITPQGAWSSGYVTVADGRIDRVSRRRPTSVPVLETDGVILPGLLDLHGHPEFNVF
FT                   AAWEPPKLYPNRYAWRRSTAYKQLVRDPQNALLSTVPPQTQTRYAEVRALVGGVTGIQG
FT                   AASASSSASAEPLVRNIDRWAFGAHRARSLVDLPTGSFGKESFDRIMAHIAAGTVNAFY
FT                   LHLSEGRRGDAVSTEEFRRFVDLGAATPATNIIHGSALTVTDLHEVADAGCRLVWSPQS
FT                   NLRLYGETTLAGEALRAGVPVALGADWLPSGSTSLLAEMKVARRELARQEHPVAAADLV
FT                   AMVTSVAARVAGLDEHLGSVAVGRPADLLVLERHHRDPYESVCLADPSWVELVCIGGDV
FT                   TYGRVDWFDELSGGAVGSTVEDLVAWGKPMRLDTGFQSPASGATPSLTEIRALLTAAYP
FT                   PVGPIFA"
     MADPLRTGPA PGRVTFEEAY SRGITDELPP PPRRARALPP TPFALRGAVI TPQGAWSSGY        60
     VTVADGRIDR VSRRRPTSVP VLETDGVILP GLLDLHGHPE FNVFAAWEPP KLYPNRYAWR       120
     RSTAYKQLVR DPQNALLSTV PPQTQTRYAE VRALVGGVTG IQGAASASSS ASAEPLVRNI       180
     DRWAFGAHRA RSLVDLPTGS FGKESFDRIM AHIAAGTVNA FYLHLSEGRR GDAVSTEEFR       240
     RFVDLGAATP ATNIIHGSAL TVTDLHEVAD AGCRLVWSPQ SNLRLYGETT LAGEALRAGV       300
     PVALGADWLP SGSTSLLAEM KVARRELARQ EHPVAAADLV AMVTSVAARV AGLDEHLGSV       360
     AVGRPADLLV LERHHRDPYE SVCLADPSWV ELVCIGGDVT YGRVDWFDEL SGGAVGSTVE       420
     DLVAWGKPMR LDTGFQSPAS GATPSLTEIR ALLTAAYPPV GPIFA                       465
//

If you have problems or comments...

PBIL Back to PBIL home page