(data stored in ACNUC7421 zone)

EMBL: CP002343.PE198

CP002343.PE198       Location/Qualifiers
FT   CDS             217202..218068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0202"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro IPR013123:
FT                   IPR001537; KEGG: kse:Ksed_01710 rRNA methylase; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; SPTR: Putative rRNA
FT                   methylase; PFAM: SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46760"
FT                   /db_xref="GOA:E6S620"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E6S620"
FT                   /protein_id="ADU46760.1"
FT                   /translation="MNLPRDLSVSSPSNPRLKALVALRRRRVREETGQTIVEGHEEIRL
FT                   ALDAGVTPRTLYVAEELFSPSGRAGSQEIGTQPELVERLRAAGVEIVRLSPAAYAKVSY
FT                   REGPDGLLAVVDDVGVPLASLTVDGPSWLGLVAQRIEKPGNLGAMLRTADAAGVDAVVA
FT                   ADPVTDWGNPNVVRASKGTLFAVPVASGTTSETLAWLAHGAVTLVVTTPETDLLHTEVD
FT                   YTGRVAIAVGSEKHGVDDALLVAATHRVRIPMHGRANSLNVSVAAAVVLYEAVRQRASR
FT                   LGGGGPA"
     MNLPRDLSVS SPSNPRLKAL VALRRRRVRE ETGQTIVEGH EEIRLALDAG VTPRTLYVAE        60
     ELFSPSGRAG SQEIGTQPEL VERLRAAGVE IVRLSPAAYA KVSYREGPDG LLAVVDDVGV       120
     PLASLTVDGP SWLGLVAQRI EKPGNLGAML RTADAAGVDA VVAADPVTDW GNPNVVRASK       180
     GTLFAVPVAS GTTSETLAWL AHGAVTLVVT TPETDLLHTE VDYTGRVAIA VGSEKHGVDD       240
     ALLVAATHRV RIPMHGRANS LNVSVAAAVV LYEAVRQRAS RLGGGGPA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page