(data stored in ACNUC7421 zone)

EMBL: CP002343.PE199

CP002343.PE199       Location/Qualifiers
FT   CDS             218117..218752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_01720 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46761"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E6S621"
FT                   /protein_id="ADU46761.1"
FT                   /translation="MRVDHVSYAAEHDGLQATAERLSKLLGVEPVDGGVHPRFGTRNVI
FT                   LPLADRNYVEVVEVLDHPASDKAPFGQAVRARSEAGGGWLGWVVAVDDLTAAEKRLGRE
FT                   AVEGNRHRPDGTELRWRQIGIRGLIADPQVPYFIQWEDISLHPANGSAAQVHIGELQIA
FT                   GDPARVREWLGVDQTFDKGDIHFTFVAPHGTPGLLSVTFHTPDGDVTI"
     MRVDHVSYAA EHDGLQATAE RLSKLLGVEP VDGGVHPRFG TRNVILPLAD RNYVEVVEVL        60
     DHPASDKAPF GQAVRARSEA GGGWLGWVVA VDDLTAAEKR LGREAVEGNR HRPDGTELRW       120
     RQIGIRGLIA DPQVPYFIQW EDISLHPANG SAAQVHIGEL QIAGDPARVR EWLGVDQTFD       180
     KGDIHFTFVA PHGTPGLLSV TFHTPDGDVT I                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page