(data stored in ACNUC7421 zone)

EMBL: CP002343.PE2

CP002343.PE2         Location/Qualifiers
FT   CDS             2567..3694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: kse:Ksed_00020
FT                   DNA polymerase III, beta subunit; PFAM: DNA polymerase III
FT                   beta chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III subunit
FT                   beta; TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46564"
FT                   /db_xref="GOA:E6SDW1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW1"
FT                   /protein_id="ADU46564.1"
FT                   /translation="MKFRVERDVLAEAVTWVARGVPARPPVPVLAGVLLEAAEDGTLTL
FT                   SAFDYEVSARITVPADVAEAGQVLVLGRLLAEISRNLPAKPIDISTDGTKLNVTCGSSR
FT                   FSLREMPVADYPTLPAAPEPSGTIAGDVFTQAVAQVSIAADRGDTLPILTGVRMEVEGD
FT                   KIVLLATDRYRLAMRELTWSPASPAASHVALIPARQLSETAKALGASGSVQIALGGGGD
FT                   GLIGFEAGQRQATTRLLDGEYPKVTSIFPSSVDTEAVIETAALEEAVKRVALVAERNTP
FT                   VLLKFTDGQVAIEAGTGDDAQASEAVEAVLHGPEIQIAFNPQYLLDGLHAVGQPWSRLS
FT                   FTQPSRPAVLTGQAEADSDTDASYRYVLMPVRFAS"
     MKFRVERDVL AEAVTWVARG VPARPPVPVL AGVLLEAAED GTLTLSAFDY EVSARITVPA        60
     DVAEAGQVLV LGRLLAEISR NLPAKPIDIS TDGTKLNVTC GSSRFSLREM PVADYPTLPA       120
     APEPSGTIAG DVFTQAVAQV SIAADRGDTL PILTGVRMEV EGDKIVLLAT DRYRLAMREL       180
     TWSPASPAAS HVALIPARQL SETAKALGAS GSVQIALGGG GDGLIGFEAG QRQATTRLLD       240
     GEYPKVTSIF PSSVDTEAVI ETAALEEAVK RVALVAERNT PVLLKFTDGQ VAIEAGTGDD       300
     AQASEAVEAV LHGPEIQIAF NPQYLLDGLH AVGQPWSRLS FTQPSRPAVL TGQAEADSDT       360
     DASYRYVLMP VRFAS                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page