(data stored in ACNUC7421 zone)

EMBL: CP002343.PE20

CP002343.PE20        Location/Qualifiers
FT   CDS             complement(22375..22833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_4843 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46582"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX9"
FT                   /protein_id="ADU46582.1"
FT                   /translation="MAIARKLKISHDEVFPHGAYLVSEVTPVVDYDRSTKDNKVQQLDK
FT                   ETGLPMWTVDVLDADPEATKKNRTVSVKLIAKVQPVPPASDGSSPFTRVVFDGLTATPW
FT                   TDTSKCKPPEPGRGHRCGAQNAWSLRADGMSAPGKSAPAPNPSPNKAA"
     MAIARKLKIS HDEVFPHGAY LVSEVTPVVD YDRSTKDNKV QQLDKETGLP MWTVDVLDAD        60
     PEATKKNRTV SVKLIAKVQP VPPASDGSSP FTRVVFDGLT ATPWTDTSKC KPPEPGRGHR       120
     CGAQNAWSLR ADGMSAPGKS APAPNPSPNK AA                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page