(data stored in ACNUC7421 zone)

EMBL: CP002343.PE200

CP002343.PE200       Location/Qualifiers
FT   CDS             complement(218742..220340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0204"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="COGs: COG2217 Cation transport ATPase; InterPro
FT                   IPR005834; KEGG: mmi:MMAR_0231 cation transporter p-type
FT                   ATPase CtpA_1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: Cation-transporting P-type ATPase; PFAM:
FT                   haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46762"
FT                   /db_xref="GOA:E6S622"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6S622"
FT                   /protein_id="ADU46762.1"
FT                   /translation="MQGRDDRSPRADELLTKLRRRAEALGSAGAAPGEDEHPAAALPPP
FT                   GARTRLLVALVLTVPVVALALWANDSTVGRWAQVVLTAVILGWSAGPLVAAAGRTLRAL
FT                   RPGPEVPVLLGALVSWAASVTDLVRGAPEQWFGAAAVAATLLLLVRHVAARAHAAAGPD
FT                   MPQPTVVDRLARWLPPVVLLVAAVVLVVRLRTGHTVADSLSATVAVLFIASLPAAALAA
FT                   PAALAAARARAERRLGSAPAAGTLARSATLDTVVINRTGLLTTGDLALRKIAVTGRLSK
FT                   KAALIAAAAVEQGSDHPIARAIVAGAGQARVDLPRIRDFEANPGEGASARIKDTEVTVG
FT                   KAALFEHVDPDLLAHADGTPGRTVFVGWGGRARAALTVEDTIRETSRPAIARLKGLGLT
FT                   PYLLTEDGEAHARGLAAAVGIDPGKVRSGSRGKAVTDRDLVSELQRQGRRVAVIGRAPA
FT                   DLLFEADDVDAAADTIELAQQTQSVIRQHLGWALGYNVIALVAGGLGWVHPTWAAILAA
FT                   VAAFVPLASAQRLRS"
     MQGRDDRSPR ADELLTKLRR RAEALGSAGA APGEDEHPAA ALPPPGARTR LLVALVLTVP        60
     VVALALWAND STVGRWAQVV LTAVILGWSA GPLVAAAGRT LRALRPGPEV PVLLGALVSW       120
     AASVTDLVRG APEQWFGAAA VAATLLLLVR HVAARAHAAA GPDMPQPTVV DRLARWLPPV       180
     VLLVAAVVLV VRLRTGHTVA DSLSATVAVL FIASLPAAAL AAPAALAAAR ARAERRLGSA       240
     PAAGTLARSA TLDTVVINRT GLLTTGDLAL RKIAVTGRLS KKAALIAAAA VEQGSDHPIA       300
     RAIVAGAGQA RVDLPRIRDF EANPGEGASA RIKDTEVTVG KAALFEHVDP DLLAHADGTP       360
     GRTVFVGWGG RARAALTVED TIRETSRPAI ARLKGLGLTP YLLTEDGEAH ARGLAAAVGI       420
     DPGKVRSGSR GKAVTDRDLV SELQRQGRRV AVIGRAPADL LFEADDVDAA ADTIELAQQT       480
     QSVIRQHLGW ALGYNVIALV AGGLGWVHPT WAAILAAVAA FVPLASAQRL RS               532
//

If you have problems or comments...

PBIL Back to PBIL home page