(data stored in ACNUC7421 zone)

EMBL: CP002343.PE201

CP002343.PE201       Location/Qualifiers
FT   CDS             220512..220823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0205"
FT                   /product="protein of unknown function DUF156"
FT                   /note="COGs: COG1937 conserved hypothetical protein;
FT                   InterPro IPR003735; KEGG: kfl:Kfla_1527 protein of unknown
FT                   function DUF156; PFAM: protein of unknown function DUF156;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised BCR, COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46763"
FT                   /db_xref="GOA:E6S623"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S623"
FT                   /protein_id="ADU46763.1"
FT                   /translation="MDHGTEAVPHQHGYIHQKDDYLRRLRRIEGQSRGLQRMVDEEQYC
FT                   IDILTQISAMTKALQSVALGLLDEHIAHCVVDAVREGGPDAELKLKEASDAIARLVRS"
     MDHGTEAVPH QHGYIHQKDD YLRRLRRIEG QSRGLQRMVD EEQYCIDILT QISAMTKALQ        60
     SVALGLLDEH IAHCVVDAVR EGGPDAELKL KEASDAIARL VRS                         103
//

If you have problems or comments...

PBIL Back to PBIL home page