(data stored in ACNUC7421 zone)

EMBL: CP002343.PE203

CP002343.PE203       Location/Qualifiers
FT   CDS             221510..222451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0019 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46765"
FT                   /db_xref="UniProtKB/TrEMBL:E6S625"
FT                   /protein_id="ADU46765.1"
FT                   /translation="MTTVTRIVGFALGLVVVFVLALGLGRVVGPVGEPPAAHAGSSGGG
FT                   AGSADLPAAGLPGGLTISDAGYTLRLSAPTAPAGRGVPVSFAVTGPDGTPVTDYEVEHE
FT                   KELHLIAVRRDFTGYQHVHPTLRADGTWSAALDLEPGVWRLFADFTATGAGALTLGTDL
FT                   SVPGTAALAAPVGETRTVTVDGYTVSITGDLVAGQDADLSFSVRKDGAPVADLQPYLGA
FT                   YGHLVALRQGDLAYLHVHPDGAPGDGRTRPGPDVVFHASVPSAGAYRLYLDFQHDGVVR
FT                   TAPLSVTAHGSAAPAEPAPASSGTTSDHGDDH"
     MTTVTRIVGF ALGLVVVFVL ALGLGRVVGP VGEPPAAHAG SSGGGAGSAD LPAAGLPGGL        60
     TISDAGYTLR LSAPTAPAGR GVPVSFAVTG PDGTPVTDYE VEHEKELHLI AVRRDFTGYQ       120
     HVHPTLRADG TWSAALDLEP GVWRLFADFT ATGAGALTLG TDLSVPGTAA LAAPVGETRT       180
     VTVDGYTVSI TGDLVAGQDA DLSFSVRKDG APVADLQPYL GAYGHLVALR QGDLAYLHVH       240
     PDGAPGDGRT RPGPDVVFHA SVPSAGAYRL YLDFQHDGVV RTAPLSVTAH GSAAPAEPAP       300
     ASSGTTSDHG DDH                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page