(data stored in ACNUC7421 zone)

EMBL: CP002343.PE204

CP002343.PE204       Location/Qualifiers
FT   CDS             222451..224775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0209"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR006121: IPR008250: IPR005834: IPR006403: IPR
FT                   006416: IPR001757: IPR018303: IPR017969: IPR000150:
FT                   IPR000695; KEGG: rop:ROP_pROB01-02380 putative
FT                   copper-transporting ATPase CopA; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: Putative
FT                   copper-transporting ATPase CopA; TIGRFAM: heavy metal
FT                   translocating P-type ATPase; copper-translocating P-type
FT                   ATPase; ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; PFAM: E1-E2 ATPase; Heavy-metal-associated
FT                   domain; haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   copper-(or silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46766"
FT                   /db_xref="GOA:E6S626"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6S626"
FT                   /protein_id="ADU46766.1"
FT                   /translation="MTTTPTTTPGGASLGLPSAPGAIELEITGMTCASCANRIERKLNK
FT                   LDGVTATVNYATEKAKVSFPDTLSAEELVKAVEAAGYGATVPAPPVTAEGAEGPSGGEA
FT                   SPAAYDRVRALRDRLVVSAVLSLPVIAMAMVSALQFDYWQWASLTLAAPVVVWGAWPFH
FT                   KAAWTNLRHGTTTMDTLVSMGVLAAFGWSLYALFLGTAGMPGMVHPFELTISRTDGAGN
FT                   IYLEAAAGVTTFLLAGRYFEARSKRQAGAALRALLELGAKDVSVLRDGLSGQVEERIPT
FT                   SQLQVGMRFVVRPGEKIATDGVVEDGTSAVDAAMLTGESVPVEVGPGSAVAGATINAGG
FT                   RIVVRATRVGSDTQLAQMARLVEDAQNGKAQVQRLADRISGFFVPIVIGLSAATLGFWL
FT                   GTGAGAAAAFTAAVAVLIIACPCALGLATPTALMVGTGRGAQLGILIKGPEVLESTRQV
FT                   DTIVLDKTGTVTTGAMALHAVVAADGEDEAEVLRLAGAVEDASEHPVARAVAAGAKERL
FT                   GALPAVSGFESTQGLGVRGEVDGSDVYVGRPVFLAERRQMRCTELDAAATEHESQGSTV
FT                   VAVAWGGRMRGILVVADTIKTTSAQAIQELRDLGLTPILLTGDNERVARTVAAQVGIAE
FT                   ADVIADVLPADKVDVVKRLQESGKVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEAS
FT                   DLTLVRGDLRVAADAIRLARRTLRTIKGNLFWAFAYNVAAIPLAAAGLLNPMLAGAAMA
FT                   FSSVFVVSNSLRLRGFRATAA"
     MTTTPTTTPG GASLGLPSAP GAIELEITGM TCASCANRIE RKLNKLDGVT ATVNYATEKA        60
     KVSFPDTLSA EELVKAVEAA GYGATVPAPP VTAEGAEGPS GGEASPAAYD RVRALRDRLV       120
     VSAVLSLPVI AMAMVSALQF DYWQWASLTL AAPVVVWGAW PFHKAAWTNL RHGTTTMDTL       180
     VSMGVLAAFG WSLYALFLGT AGMPGMVHPF ELTISRTDGA GNIYLEAAAG VTTFLLAGRY       240
     FEARSKRQAG AALRALLELG AKDVSVLRDG LSGQVEERIP TSQLQVGMRF VVRPGEKIAT       300
     DGVVEDGTSA VDAAMLTGES VPVEVGPGSA VAGATINAGG RIVVRATRVG SDTQLAQMAR       360
     LVEDAQNGKA QVQRLADRIS GFFVPIVIGL SAATLGFWLG TGAGAAAAFT AAVAVLIIAC       420
     PCALGLATPT ALMVGTGRGA QLGILIKGPE VLESTRQVDT IVLDKTGTVT TGAMALHAVV       480
     AADGEDEAEV LRLAGAVEDA SEHPVARAVA AGAKERLGAL PAVSGFESTQ GLGVRGEVDG       540
     SDVYVGRPVF LAERRQMRCT ELDAAATEHE SQGSTVVAVA WGGRMRGILV VADTIKTTSA       600
     QAIQELRDLG LTPILLTGDN ERVARTVAAQ VGIAEADVIA DVLPADKVDV VKRLQESGKV       660
     VAMVGDGVND AAALAQADLG LAMGTGTDVA IEASDLTLVR GDLRVAADAI RLARRTLRTI       720
     KGNLFWAFAY NVAAIPLAAA GLLNPMLAGA AMAFSSVFVV SNSLRLRGFR ATAA             774
//

If you have problems or comments...

PBIL Back to PBIL home page